Name: purification and refolding to amyloid fibrils of (his)6-tagged recombinant shadoo protein expressed as inclusion bodies in e. coli
Uploaded: 2015-12-19T14:00:00
Description: Watch this Scientific Journal Video about Purification and Refolding to Amyloid Fibrils of His6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli at JoVE.com

The authors would like to acknowledge Natalie Doude and David Westerway (University of Alberta) for providing us Sho cDNA, Christophe Chevalier (INRA) for plasmid construction, Michel Br&#233;mont (INRA) for providing us BL21Sol bacteria; Christine Longin (INRA) for TEM assistance and Edith Pajot-Augy (INRA) for comments and proofreading.

1. Erzeugung von Plasmid und Expression Shadoo Hinweis: Das Gen, das murine Shadoo Protein (Shadoo 25-122), wurde in den Expressionsvektor pET-28 11 subkloniert. Dieser Klon wurde in den E. transformierten coli SoluBL21 Bakterienstamm, um Shadoo Protein mit einem N-terminalen Hexahistidin-Tag, (HHHHHHHHHHSSGHIDDDDKHMKGGRGGARGSARGVRGGARGASRVRVRP APRYGSSLRVAAAGAAAGAAAGVAAGLATGSGWRRTSGPGELGLEDDENGAMGGNGTDRGVYSYWAWTSG) zum Ausdruck bringen, wie zuvor 11...

<ol>
	<li>Biasini, E., Turnbaugh, J. A., Unterberger, U., Harris, D. A. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Prion+protein+at+the+crossroads+of+physiology+and+disease.">Prion protein at the crossroads of physiology and disease.</a> Trends in Neurosciences. 35, 92-103 (2012).</li><li>Colby, D. W., Prusiner, S. B. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=De+novo+generation+of+prion+strains.">De novo generation of prion strains.</a> Nature Reviews. Microbiology. 9, 771-777 (2011).</li><li>Chiti, F., Dobson, C. M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Protein+misfolding,+functional+amyloid,+and+human+disease.">Protein misfolding, functional amyloid, and human disease.</a> Annual Review of Biochemistry. 75, 333-366 (2006).</li><li>Nelson, R., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Structure+of+the+cross-beta+spine+of+amyloid-like+fibrils.">Structure of the cross-beta spine of amyloid-like fibrils.</a> Nature. 435, 773-778 (2005).</li><li>Murphy, R. M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Kinetics+of+amyloid+formation+and+membrane+interaction+with+amyloidogenic+proteins.">Kinetics of amyloid formation and membrane interaction with amyloidogenic proteins.</a> Biochimica et Biophysica Acta. 1768, 1923-1934 (2007).</li><li>Steunou, S., Chich, J. F., Rezaei, H., Vidic, J. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Biosensing+of+lipid-prion+interactions:+insights+on+charge+effect,+Cu(II)-ions+binding+and+prion+oligomerization.">Biosensing of lipid-prion interactions: insights on charge effect, Cu(II)-ions binding and prion oligomerization.</a> Biosensors &amp; Bioelectronics. 26, 1399-1406 (2010).</li><li>Watts, J. C., Westaway, D. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+prion+protein+family:+diversity,+rivalry,+and+dysfunction.">The prion protein family: diversity, rivalry, and dysfunction.</a> Biochimica et Biophysica Acta. 1772, 654-672 (2007).</li><li>Westaway, D., Daude, N., Wohlgemuth, S., Harrison, P. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+PrP-like+proteins+Shadoo+and+Doppel.">The PrP-like proteins Shadoo and Doppel.</a> Topics in Current Chemistry. 305, 225-256 (2011).</li><li>Baillod, P., Garrec, J., Tavernelli, I., Rothlisberger, U. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Prion+versus+doppel+protein+misfolding:+new+insights+from+replica-exchange+molecular+dynamics+simulations.">Prion versus doppel protein misfolding: new insights from replica-exchange molecular dynamics simulations.</a> Biochemistry. 52, 8518-8526 (2013).</li><li>Daude, N., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Wild-type+Shadoo+proteins+convert+to+amyloid-like+forms+under+native+conditions.">Wild-type Shadoo proteins convert to amyloid-like forms under native conditions.</a> Journal of Neurochemistry. 113, 92-104 (2010).</li><li>Li, Q., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Shadoo+binds+lipid+membranes+and+undergoes+aggregation+and+fibrillization.">Shadoo binds lipid membranes and undergoes aggregation and fibrillization.</a> Biochemical and Biophysical Research Communications. 438, 519-525 (2013).</li><li>Watts, J. C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+CNS+glycoprotein+Shadoo+has+PrP(C)-like+protective+properties+and+displays+reduced+levels+in+prion+infections.">The CNS glycoprotein Shadoo has PrP(C)-like protective properties and displays reduced levels in prion infections.</a> The EMBO Journal. 26, 4038-4050 (2007).</li><li>Watts, J. C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Protease-resistant+prions+selectively+decrease+Shadoo+protein.">Protease-resistant prions selectively decrease Shadoo protein.</a> PLoS Pathogens. 7, e1002382 (2011).</li><li>Westaway, D., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Down-regulation+of+Shadoo+in+prion+infections+traces+a+pre-clinical+event+inversely+related+to+PrP(Sc)+accumulation.">Down-regulation of Shadoo in prion infections traces a pre-clinical event inversely related to PrP(Sc) accumulation.</a> PLoS Pathogens. 7, e1002391 (2011).</li><li>Chevalier, C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=PB1-F2+influenza+A+virus+protein+adopts+a+beta-sheet+conformation+and+forms+amyloid+fibers+in+membrane+environments.">PB1-F2 influenza A virus protein adopts a beta-sheet conformation and forms amyloid fibers in membrane environments.</a> The Journal of Biological Chemistry. 285, 13233-13243 (2010).</li><li>Tarus, B., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Oligomerization+paths+of+the+nucleoprotein+of+influenza+A+virus.">Oligomerization paths of the nucleoprotein of influenza A virus.</a> Biochimie. 94, 776-785 (2012).</li><li>Biancalana, M., Koide, S. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Molecular+mechanism+of+Thioflavin-T+binding+to+amyloid+fibrils.">Molecular mechanism of Thioflavin-T binding to amyloid fibrils.</a> Biochimica et Biophysica Acta. 1804, 1405-1412 (2010).</li><li>Minic, J., Sautel, M., Salesse, R., Pajot-Augy, E. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Yeast+system+as+a+screening+tool+for+pharmacological+assessment+of+g+protein+coupled+receptors.">Yeast system as a screening tool for pharmacological assessment of g protein coupled receptors.</a> Current Medicinal Chemistry. 12, 961-969 (2005).</li><li>Schein, C. H. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=A+cool+way+to+make+proteins.">A cool way to make proteins.</a> Nature Biotechnology. 22, 826-827 (2004).</li><li>Sorensen, H. P., Mortensen, K. K. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Advanced+genetic+strategies+for+recombinant+protein+expression+in+Escherichia+coli.">Advanced genetic strategies for recombinant protein expression in Escherichia coli.</a> Journal of Biotechnology. 115, 113-128 (2005).</li><li>Zhang, J., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Disruption+of+glycosylation+enhances+ubiquitin-mediated+proteasomal+degradation+of+Shadoo+in+Scrapie-infected+rodents+and+cultured+cells.">Disruption of glycosylation enhances ubiquitin-mediated proteasomal degradation of Shadoo in Scrapie-infected rodents and cultured cells.</a> Molecular Neurobiology. 49, 1373-1384 (2014).</li><li>Englund, P. T. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+structure+and+biosynthesis+of+glycosyl+phosphatidylinositol+protein+anchors.">The structure and biosynthesis of glycosyl phosphatidylinositol protein anchors.</a> Annual Review of Biochemistry. 62, 121-138 (1993).</li><li>Puig, B., Altmeppen, H., Glatzel, M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+GPI-anchoring+of+PrP:+implications+in+sorting+and+pathogenesis.">The GPI-anchoring of PrP: implications in sorting and pathogenesis.</a> Prion. 8, 11-18 (2014).</li></ol>

Ein einfaches und effizientes Protokoll sowohl für die Expression und Reinigung einer großen Menge an rekombinantem Maus Shadoo Protein präsentiert. Das beschriebene Verfahren ermöglicht erfolgreiche Solubilisierung und Reinigung von (His 6) -markierte rekombinanten Shadoo Protein. Es ist wichtig, wie in dem Dokument darauf hingewiesen, dass, wenn in einem prokaryontischen Bakteriums E. ausgedrückt coli Shadoo sammelt sich in Einschlusskörpern. Vor Shadoo Reinigung haben Bakterien, dur...

Prion neurodegenerativen Erkrankungen, die bovine spongiforme Enzephalopathie bei Rindern, Scrapie bei Schafen und Creutzfeldt-Jakob-Krankheit beim Menschen, sind tödlich und unheilbar. Prion-Krankheiten durch Konformationsänderungen des zellulären Prionproteins im Wesentlichen aus α-Helices in die Quer β-Faltblatt gekennzeichnet angereichert Amyloid Konformer 1,2. Cross-β-Strukturen enthalten dicht gepackt und hochgeordnete kristalline artigen β-sheets stabilisiert mit 3,4-Wasserstoffbrücken. Prion Amyloide sich selbst replizieren aufgrund der β-Stränge an die wachsende Kante, die eine Vorlage für die Rekrutierung geben und Umwandeln eines monomeren Proteineinheit. Nach Angaben der &quot;Nur-Protein-Hypothese&quot;, die Amyloid-Konformer des Prionprotein der einzige Infektionserreger. Jedoch einige andere Biomoleküle wurden vorgeschlagen wesentlich, Prion-Erkrankungen sein. Zum Beispiel werden die Zellmembranen gedacht, ein Ort, wo conversi seinauf erfolgt und einige negativ geladene Lipide sind gezeigt worden, um die Konvertierung zu 5,6 zu erhöhen. Darüber hinaus können einige Proteine ​​auch im Prion-Erkrankungen beteiligt. Insbesondere gibt es zwei weitere Mitglieder des Prionproteinfamilie: Doppel und Shadoo 7,8. Doppel weist eine relativ steife Struktur mit Di-Sulfidbrücken stabilisiert zu werden, keine spontan polymerisieren und Aggregat an Amyloidfibrillen 9. Im Gegensatz dazu, ähnlich wie bei Prion-Protein, Shadoo eine β-Faltblatt-angereicherten Struktur und Selbstassoziation in Amyloidfibrillen Strukturen erlassen. Es konnte gezeigt werden, dass Shadoo kann unter nativen Bedingungen oder bei der Bindung negativ geladenen Membranen 10,11 fibrillieren. Umwandlung von Shadoo in amyloidartigen Fasern können mit Krankheiten in Verbindung gebracht werden. Tatsächlich sind die Mechanismen, durch die Amyloid-ähnliche Strukturen Krankheiten verursachen kaum verstanden. Shadoo trägt eine hydrophobe Domäne (HD) und eine Reihe von Tandem Arg / Gly wiederholt ähnliche to den N-terminalen Teil des Prion-Proteins (1A). Als die N-terminalen Teil des Prionproteins wird Shadoo stark positiv und scheint eine nativ unstrukturierte Protein 11,12 sein. Shadoo scheint funktionell auf Prionen-Erkrankungen sein, da es direkt binden Prionprotein. Zusätzlich ist seine Expression unten während Prion Pathologie 13,14 geregelt. Jedoch ist die Rolle von Shadoo Prionenerkrankungen noch nicht etabliert. Wir entwickelten ein Plasmid, das die codierende Sequenz der Maus Shadoo Gens. Das Plasmid wurde verwendet, um E.-Transformation coli zur Herstellung von N-terminalen His-6-Fusionsprotein Shadoo. Dieses Expressionssystem ist in unserem Labor etabliert und wird häufig in unserer laufenden Projekte 6,15,16 verwendet. Ein wichtiges Thema für die Expression von Shadoo ist die Wahl des E. coli-Stamm. Während kompetente BL21 Bakterienstamm wird häufig für die Expression von rekombinanten Pro verwendetProteine ​​Shadoo wurde erfolgreich exprimiert und nur aus der transformierten SoluBL21 Bakterienstamm gereinigt. SoluBL21 kompetente E. coli ist eine verbesserte Mutante BL21 Wirtsstamm für die Produktion von Proteinen, deren Expression in der Mutter BL21 gab keinen nachweisbaren löslichen Produkt entwickelt. High-Level-Expression Shadoo in SoluBL21 E. coli führt zu einer Akkumulation des Proteins in Einschlusskörpern. Als eine allgemeine Funktion, wenn ein nicht-native Protein ist stark in E. ausgedrückt coli neigt dieses Protein in unlöslicher Einschlußkörper akkumulieren. Shadoo Aggregate vermutlich durch nicht-kovalente oder ionische Wechselwirkungen hydrophobe (oder einer Kombination von beiden), um hoch angereichertes dynamischen Strukturen durch das Protein in unterschiedlichem Maße gefaltet ist. Folglich umfasst die Reinigung wenigstens zwei Schritte: (i) eine selektive Trennung des Proteins von anderen Biomolekülen in einer Denaturierung Medium und (ii) eine Renaturierung des gereinigten Proteins mit in vitro FaltungsTechniken. Die selektive Abtrennung von Shadoo wurde in einer Pufferlösung, enthaltend 8 M Harnstoff (oder alternativ 6 M Guanidin-HCl) gelöst. (I) die Renaturierung in einem sauren pH-Lösung eine unstrukturierte monomeren Shadoo Protein oder (ii) die Renaturierung in einer Lösung mit pH ≥ 7 bis Shadoo polymerisierten erhalten: Die Harnstoffentfernung und die Renaturierung des Proteins kann durch Anwendung verschiedener Protokolle durchgeführt werden in stabile Amyloidfasern mit charakteristischen Quer β-Blatt-Motive.

<table>
	<tbody>
		<tr>
			<td>AKTA FPLC&#160;</td>
			<td>GE, Amersham</td>
			<td># 1363</td>
			<td></td>
		</tr>
		<tr>
			<td>HiLoad 16/60 Superdex</td>
			<td>GE Healthcare</td>
			<td>17-1069-01</td>
			<td></td>
		</tr>
		<tr>
			<td>HiTrap IMAC</td>
			<td>GE Healthcare</td>
			<td>GE17-0920-05</td>
			<td></td>
		</tr>
		<tr>
			<td>HiPrep26/10 Desalting column</td>
			<td>GE Healthcare</td>
			<td>GE17-5087-01</td>
			<td></td>
		</tr>
		<tr>
			<td>SoluBL21 Competent E. coli</td>
			<td>Genlantis</td>
			<td>C700200</td>
			<td></td>
		</tr>
		<tr>
			<td>pET-28b+</td>
			<td>Novogen</td>
			<td>69865-3</td>
			<td></td>
		</tr>
		<tr>
			<td>IPTG</td>
			<td>Sigma-Aldrich</td>
			<td>I6758</td>
			<td></td>
		</tr>
		<tr>
			<td>LB-Broth medium</td>
			<td>Sigma-Aldrich</td>
			<td>L3022</td>
			<td></td>
		</tr>
		<tr>
			<td>Eppendorf Biophotometar</td>
			<td>Eppendorf</td>
			<td>550507804</td>
			<td></td>
		</tr>
		<tr>
			<td>Trito X-100</td>
			<td>Life Technologies</td>
			<td>85111</td>
			<td></td>
		</tr>
		<tr>
			<td>NiSO4</td>
			<td>Sigma-Aldrich</td>
			<td>656895</td>
			<td></td>
		</tr>
		<tr>
			<td>EDTA</td>
			<td>Sigma-Aldrich</td>
			<td>E6758</td>
			<td></td>
		</tr>
		<tr>
			<td>Tris-HCl</td>
			<td>Sigma-Aldrich</td>
			<td>RES3098T</td>
			<td></td>
		</tr>
		<tr>
			<td>Protease Inhibitor Cocktail Tablets</td>
			<td>Roche</td>
			<td>4693116001</td>
			<td></td>
		</tr>
		<tr>
			<td>NaCl</td>
			<td>Sigma-Aldrich</td>
			<td>746398</td>
			<td></td>
		</tr>
		<tr>
			<td>Imidazol</td>
			<td>Sigma-Aldrich</td>
			<td>I5513</td>
			<td></td>
		</tr>
		<tr>
			<td>Gdn-HCl</td>
			<td>Sigma-Aldrich</td>
			<td>G4505</td>
			<td></td>
		</tr>
		<tr>
			<td>protein size marker&#160;</td>
			<td>Thermo Fisher Scientific</td>
			<td>26620</td>
			<td></td>
		</tr>
	</tbody>
</table>

purification and refolding to amyloid fibrils of (his)6-tagged recombinant shadoo protein expressed as inclusion bodies in e. coli

Der Escherichia-coli-Expressionssystem ist ein leistungsfähiges Werkzeug für die Herstellung von rekombinanten eukaryotischen Proteinen. Wir verwenden es, um Shadoo, ein Protein, an das Prion-Familie gehören, zu erzeugen. Ein chromatographisches Verfahren zur Reinigung von (His) 6 -markierten rekombinanten Shadoo ausgedrückt als Einschlußkörper beschrieben. Die Einschlusskörper in 8 M Harnstoff solubilisiert und auf eine Ni 2+ -charged Säule gebunden zu Ionen-Affinitätschromatographie durchzuführen. Gebundenen Proteine ​​werden mit einem Gradienten von Imidazol eluiert. Fraktionen Shadoo Protein enthalten, werden Größenausschlußchromatographie unterzogen wird, eine hoch gereinigte Protein zu erhalten. Im letzten Schritt gereinigt Shadoo entsalzt, um Salze, Harnstoff und Imidazol zu entfernen. Rekombinante Shadoo Protein ist ein wichtiges Reagenz zur biophysikalischen und biochemischen Studien der Proteinkonformation Störungen bei Prionenerkrankungen auftreten. Viele Berichte gezeigt, dass neurodegenerative Erkrankungen Prion stammen aus der Ablagerung von Stichle, bestellt Amyloidfibrillen. Musterprotokolle beschreiben, wie Shadoo in Amyloidfibrillen bei sauren und neutralen fibrillieren / basischen pH-Werten dargestellt. Die Methoden, wie man produzieren und fibrillieren Shadoo kann Forschung in Labors arbeiten an Prionenerkrankungen zu erleichtern, da es für die Produktion von großen Mengen an Protein in eine schnelle und kostengünstige Weise.

Etwa 5-10 mg gereinigtes Shadoo Protein pro Liter Bakterienkultur erhalten. Ein Zwei-Schritt-Reinigung ist notwendig, um rekombinante Shadoo hoher Reinheit zu erhalten. Der erste Schritt ist durch Affinitätschromatographie mit einem Ni 2+ -charged Spalte, die His-Tag-Proteine ​​behält geführt. Eluierten Fraktionen werden der SDS-PAGE unterworfen und mit Coomassie Brilliant Blue (5A) angefärbt. Fraktionen Shadoo Protein enthalten, werden vereinigt und weiter durch Grßenausschlußchrom...

Watch this Scientific Journal Video about Purification and Refolding to Amyloid Fibrils of His6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli at JoVE.com

Purification and Refolding to Amyloid Fibrils of His6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli

A two-step chromatographic method is described for the purification of recombinant Shadoo protein expressed as inclusion bodies in Escherichia coli, as well as a protocol to fibrillate purified Shadoo into amyloid structures.

Reinigung und Rückfaltung an Amyloidfibrillen von (His)<sub&gt; 6</sub&gt; -markierte Recombinant Protein Shadoo als Einschlusskörper in Ausgedrückt<em&gt; E. coli</em

The Escherichia coli expression system is a powerful tool for the production of recombinant eukaryotic proteins. We use it to produce Shadoo, a protein ...

Research

JoVE Journal

Biology

Purification and Refolding to Amyloid Fibrils of (His)6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli

Patch Clamp Recording of Ion Channels Expressed in  Xenopus Oocytes

Patch Clamp Recording von Ionenkanälen in Xenopus Oozyten exprimiert

Since its development by Sakmann and Neher 1, 2, the patch clamp has become established as an extremely useful technique for electrophysiological ...

Forschung

Biologie

Staining of Proteins in Gels with Coomassie G-250 without Organic Solvent and Acetic Acid

Färbung von Proteinen in Gelen mit Coomassie G-250 ohne organische Lösungsmittel und Essigsäure

In classical protein staining protocols using Coomassie Brilliant Blue (CBB), solutions with high contents of toxic and flammable organic solvents ...

Mutagenesis and Functional Selection Protocols for Directed Evolution of Proteins in E. coli

Mutagenesis and Functional Selection Protocols for Directed Evolution of Proteins in E. coli

Mutagenese und Functional Selection Protocols for Directed Evolution von Proteinen in E. coli</em

The efficient generation of genetic diversity represents an invaluable molecular tool that can be used to label DNA synthesis, to create unique molecular ...

Purification of Hsp104, a Protein Disaggregase

Reinigung von Hsp104, ein Protein Disaggregase

Hsp104 is a hexameric AAA+ protein1 from yeast, which couples ATP hydrolysis to protein disaggregation2-10 (Fig. 1). This activity imparts two key ...

Identification of Protein Complexes in Escherichia coli using Sequential Peptide Affinity Purification in Combination with Tandem Mass Spectrometry

Identification of Protein Complexes in Escherichia coli using Sequential Peptide Affinity Purification in Combination with Tandem Mass Spectrometry

Identifizierung von Protein-Komplexen in<em&gt; Escherichia coli</em&gt; Mit Sequential Peptide Affinity Purification in Kombination mit Tandem-Massenspektrometrie

Since most cellular processes are mediated by macromolecular assemblies, the systematic identification of protein-protein interactions (PPI) and the ...

Coupled Assays for Monitoring Protein Refolding in Saccharomyces cerevisiae

Coupled Assays for Monitoring Protein Refolding in Saccharomyces cerevisiae

Gekoppelt Assays zur Überwachung Proteinrückfaltung in<em&gt; Saccharomyces cerevisiae</em

Proteostasis, defined as the combined processes of protein folding/biogenesis, refolding/repair, and degradation, is a delicate cellular balance that must ...

Purification of the Cystic Fibrosis Transmembrane Conductance Regulator Protein Expressed in Saccharomyces cerevisiae

Purification of the Cystic Fibrosis Transmembrane Conductance Regulator Protein Expressed in Saccharomyces cerevisiae

Die Reinigung des Cystic Fibrosis Transmembran Regulator-Protein in Ausgedrückt<em&gt; Saccharomyces cerevisiae</em

Defects in the cystic fibrosis transmembrane conductance regulator (CFTR) protein cause cystic fibrosis (CF), an autosomal recessive disease that ...

High Throughput Quantitative Expression Screening and Purification Applied to Recombinant Disulfide-rich Venom Proteins Produced in E. coli

High Throughput Quantitative Expression Screening and Purification Applied to Recombinant Disulfide-rich Venom Proteins Produced in E. coli

Hochdurchsatz-Screening Quantitative Expression und Aufreinigung rekombinanter zu Disulfid-reichen Proteine ​​Venom Produziert in Applied<em&gt; E. coli</em

Escherichia coli (E. coli) is the most widely used expression system for the production of recombinant proteins for structural and functional studies. ...

Non-chromatographic Purification of Recombinant Elastin-like Polypeptides and their Fusions with Peptides and Proteins from Escherichia coli

Non-chromatographic Purification of Recombinant Elastin-like Polypeptides and their Fusions with Peptides and Proteins from Escherichia coli

Nicht-chromatographischen Reinigung von rekombinantem Elastin-ähnliche Polypeptide und deren Fusionen mit Peptiden und Proteinen aus<em&gt; Escherichia coli</em

Elastin-like polypeptides are repetitive biopolymers that exhibit a lower critical solution temperature phase transition behavior, existing as soluble ...

Green Fluorescent Protein-based Expression Screening of Membrane Proteins in Escherichia coli

Green Fluorescent Protein-based Expression Screening of Membrane Proteins in Escherichia coli

Green Fluorescent Protein-basierte Screening Expression von Membranproteinen in<em&gt; Escherichia coli</em

The production of recombinant membrane proteins for structural and functional studies remains technically challenging due to low levels of expression and ...