Name: purification and refolding to amyloid fibrils of (his)6-tagged recombinant shadoo protein expressed as inclusion bodies in e. coli
Uploaded: 2015-12-19T14:00:00
Description: Watch this Scientific Journal Video about Purification and Refolding to Amyloid Fibrils of His6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli at JoVE.com

The authors would like to acknowledge Natalie Doude and David Westerway (University of Alberta) for providing us Sho cDNA, Christophe Chevalier (INRA) for plasmid construction, Michel Br&#233;mont (INRA) for providing us BL21Sol bacteria; Christine Longin (INRA) for TEM assistance and Edith Pajot-Augy (INRA) for comments and proofreading.

플라스미드 및 Shadoo 식의 1 세대 주 : 유전자 부호화 뮤린 Shadoo 단백질 (Shadoo 25부터 1백22까지)를 발현 벡터를 pET-28 (11)에 서브 클로닝 하였다. 이 클론은 E.으로 변화되었다 앞서 설명한 바와 같이 11 대장균 N 말단 헥사 히스티딘 태그 (HHHHHHHHHHSSGHIDDDDKHMKGGRGGARGSARGVRGGARGASRVRVRP APRYGSSLRVAAAGAAAGAAAGVAAGLATGSGWRRTSGPGELGLEDDENGAMGGNGTDRGVYSYWAWTSG)와 Shadoo 단백?...

<ol>
	<li>Biasini, E., Turnbaugh, J. A., Unterberger, U., Harris, D. A. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Prion+protein+at+the+crossroads+of+physiology+and+disease.">Prion protein at the crossroads of physiology and disease.</a> Trends in Neurosciences. 35, 92-103 (2012).</li><li>Colby, D. W., Prusiner, S. B. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=De+novo+generation+of+prion+strains.">De novo generation of prion strains.</a> Nature Reviews. Microbiology. 9, 771-777 (2011).</li><li>Chiti, F., Dobson, C. M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Protein+misfolding,+functional+amyloid,+and+human+disease.">Protein misfolding, functional amyloid, and human disease.</a> Annual Review of Biochemistry. 75, 333-366 (2006).</li><li>Nelson, R., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Structure+of+the+cross-beta+spine+of+amyloid-like+fibrils.">Structure of the cross-beta spine of amyloid-like fibrils.</a> Nature. 435, 773-778 (2005).</li><li>Murphy, R. M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Kinetics+of+amyloid+formation+and+membrane+interaction+with+amyloidogenic+proteins.">Kinetics of amyloid formation and membrane interaction with amyloidogenic proteins.</a> Biochimica et Biophysica Acta. 1768, 1923-1934 (2007).</li><li>Steunou, S., Chich, J. F., Rezaei, H., Vidic, J. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Biosensing+of+lipid-prion+interactions:+insights+on+charge+effect,+Cu(II)-ions+binding+and+prion+oligomerization.">Biosensing of lipid-prion interactions: insights on charge effect, Cu(II)-ions binding and prion oligomerization.</a> Biosensors &amp; Bioelectronics. 26, 1399-1406 (2010).</li><li>Watts, J. C., Westaway, D. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+prion+protein+family:+diversity,+rivalry,+and+dysfunction.">The prion protein family: diversity, rivalry, and dysfunction.</a> Biochimica et Biophysica Acta. 1772, 654-672 (2007).</li><li>Westaway, D., Daude, N., Wohlgemuth, S., Harrison, P. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+PrP-like+proteins+Shadoo+and+Doppel.">The PrP-like proteins Shadoo and Doppel.</a> Topics in Current Chemistry. 305, 225-256 (2011).</li><li>Baillod, P., Garrec, J., Tavernelli, I., Rothlisberger, U. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Prion+versus+doppel+protein+misfolding:+new+insights+from+replica-exchange+molecular+dynamics+simulations.">Prion versus doppel protein misfolding: new insights from replica-exchange molecular dynamics simulations.</a> Biochemistry. 52, 8518-8526 (2013).</li><li>Daude, N., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Wild-type+Shadoo+proteins+convert+to+amyloid-like+forms+under+native+conditions.">Wild-type Shadoo proteins convert to amyloid-like forms under native conditions.</a> Journal of Neurochemistry. 113, 92-104 (2010).</li><li>Li, Q., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Shadoo+binds+lipid+membranes+and+undergoes+aggregation+and+fibrillization.">Shadoo binds lipid membranes and undergoes aggregation and fibrillization.</a> Biochemical and Biophysical Research Communications. 438, 519-525 (2013).</li><li>Watts, J. C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+CNS+glycoprotein+Shadoo+has+PrP(C)-like+protective+properties+and+displays+reduced+levels+in+prion+infections.">The CNS glycoprotein Shadoo has PrP(C)-like protective properties and displays reduced levels in prion infections.</a> The EMBO Journal. 26, 4038-4050 (2007).</li><li>Watts, J. C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Protease-resistant+prions+selectively+decrease+Shadoo+protein.">Protease-resistant prions selectively decrease Shadoo protein.</a> PLoS Pathogens. 7, e1002382 (2011).</li><li>Westaway, D., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Down-regulation+of+Shadoo+in+prion+infections+traces+a+pre-clinical+event+inversely+related+to+PrP(Sc)+accumulation.">Down-regulation of Shadoo in prion infections traces a pre-clinical event inversely related to PrP(Sc) accumulation.</a> PLoS Pathogens. 7, e1002391 (2011).</li><li>Chevalier, C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=PB1-F2+influenza+A+virus+protein+adopts+a+beta-sheet+conformation+and+forms+amyloid+fibers+in+membrane+environments.">PB1-F2 influenza A virus protein adopts a beta-sheet conformation and forms amyloid fibers in membrane environments.</a> The Journal of Biological Chemistry. 285, 13233-13243 (2010).</li><li>Tarus, B., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Oligomerization+paths+of+the+nucleoprotein+of+influenza+A+virus.">Oligomerization paths of the nucleoprotein of influenza A virus.</a> Biochimie. 94, 776-785 (2012).</li><li>Biancalana, M., Koide, S. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Molecular+mechanism+of+Thioflavin-T+binding+to+amyloid+fibrils.">Molecular mechanism of Thioflavin-T binding to amyloid fibrils.</a> Biochimica et Biophysica Acta. 1804, 1405-1412 (2010).</li><li>Minic, J., Sautel, M., Salesse, R., Pajot-Augy, E. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Yeast+system+as+a+screening+tool+for+pharmacological+assessment+of+g+protein+coupled+receptors.">Yeast system as a screening tool for pharmacological assessment of g protein coupled receptors.</a> Current Medicinal Chemistry. 12, 961-969 (2005).</li><li>Schein, C. H. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=A+cool+way+to+make+proteins.">A cool way to make proteins.</a> Nature Biotechnology. 22, 826-827 (2004).</li><li>Sorensen, H. P., Mortensen, K. K. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Advanced+genetic+strategies+for+recombinant+protein+expression+in+Escherichia+coli.">Advanced genetic strategies for recombinant protein expression in Escherichia coli.</a> Journal of Biotechnology. 115, 113-128 (2005).</li><li>Zhang, J., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Disruption+of+glycosylation+enhances+ubiquitin-mediated+proteasomal+degradation+of+Shadoo+in+Scrapie-infected+rodents+and+cultured+cells.">Disruption of glycosylation enhances ubiquitin-mediated proteasomal degradation of Shadoo in Scrapie-infected rodents and cultured cells.</a> Molecular Neurobiology. 49, 1373-1384 (2014).</li><li>Englund, P. T. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+structure+and+biosynthesis+of+glycosyl+phosphatidylinositol+protein+anchors.">The structure and biosynthesis of glycosyl phosphatidylinositol protein anchors.</a> Annual Review of Biochemistry. 62, 121-138 (1993).</li><li>Puig, B., Altmeppen, H., Glatzel, M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+GPI-anchoring+of+PrP:+implications+in+sorting+and+pathogenesis.">The GPI-anchoring of PrP: implications in sorting and pathogenesis.</a> Prion. 8, 11-18 (2014).</li></ol>

발현 및 재조합 마우스 Shadoo 단백질의 다량의 정제 모두에 대한 쉽고 효율적인 프로토콜이 제시된다. 기재된 방법은 성공적인 가용화 및 (그의 6) -tagged Shadoo 재조합 단백질을 정제 할 수있다. 제목에서 지적했듯이 그것은 중요하다 원핵 박테리아 E. 표현하는 경우 대장균 Shadoo은 봉입체에 축적. Shadoo 정제에 앞서, 박테리아는 트리톤 X-100을 함유하는 완충액에 용해하여 초음?...

인간의 양 및 크로이츠 펠트 - 야콥병에서 소 해면상 소에서 뇌, 스크래피를 포함 프리온 신경 퇴행성 질환은 치명적 및 불치이다. 프리온 질병은 주로 가교 β 시트로, α-나선 이루어지는 세포 프리온 단백질의 형태 적 변화에 의해 특징 1,2- 콘 포머 (conformer) 아밀로이드 농후. 크로스 - β-구조는 조밀 포함 높은 순서 결정과 같은 β-시트는 수소 결합 3,4 안정화. 프리온 아밀로이드 모집에 대한 템플릿을 제공하고 단량체 단백질 변환 부 성장 가장자리에 β-가닥에 의한 자기 복제를 할 수 있습니다. &quot;단백질 만&quot;가설에 따르면, 프리온 단백질 아밀로이드 콘 포머 (conformer)가 단독 감염원이다. 그러나, 일부 다른 생체 분자 프리온 질환에 필수적인 것으로 제안되어있다. 예를 들어, 세포막 곳 어디 conversi 것으로 생각되고켜짐 일어나며 일부 음으로 하전 된 지질은 변환 처리 5,6-을 강화하는 것으로 나타났다. 또한, 일부 단백질은 또한 프리온 병리에 관여 할 수있다. Doppel 및 Shadoo 7,8 : 특히, 프리온 단백질 가족의 다른 두 멤버가있다. Doppel는 디 황화 다리와 안정 상대적으로 견고한 구조를 가지고 있으며, 아밀로이드 원 섬유 (9)에 자기 중합 집계에 실패합니다. 반면, 프리온 단백질과 유사하게, Shadoo 아밀로이드 피 브릴 구조로 β 시트 - 풍부 구조의 자기 준을 채택 할 수있다. 그것은 Shadoo가 기본 조건 또는 음전하 막 10, 11 바인딩에 피 브릴 수있는 것으로 나타났다. 아밀로이드 섬유 형상으로의 변환은 Shadoo 병리와 연관 될 수있다. 실제로, 아밀로이드 형 구조는 질병을 야기하는 메커니즘이 제대로 이해된다. Shadoo은 소수성 도메인 (HD)와 직렬의 Arg / 대 Gly 맺는 일련의 유사한 반복 t프리온 단백질 (도 1a)의 N- 말단 부분 O. 프리온 단백질의 N 말단 부분으로서, Shadoo 매우 양전하와 기본적으로 구조화 단백질 11,12 것으로 나타나고있다. 직접적 프리온 단백질에 결합 할 수 있기 때문에 Shadoo 프리온 질환과 기능적으로 관련이있을 것 같다. 또한, 그것의 발현은 다운 프리온 병리학 13,14 동안 조절된다. 그러나 프리온 질환에 Shadoo의 역할은 아직 확립되어 있지 않습니다. 우리는 마우스 Shadoo 유전자의 코딩 서열을 운반하는 플라스미드를 개발 하였다. E. 플라스미드를 형질 전환시켰다 대장균 N- 말단 그의 6 융합 Shadoo 단백질의 생산. 이 발현 시스템은 잘 우리의 실험실에 설립되어 일반적으로 우리의 진행하는 프로젝트 6,15,16에 사용됩니다. Shadoo의 표현을위한 중요한 문제는 E.의 선택 대장균 균주. 유능한 BL21 균주는 일반적으로 재조합 프로의 표현에 사용되는 동안teins Shadoo 성공적으로 표현하고 변환 된 SoluBL21 균주에서만 정제 하였다. SoluBL21 관할 E. 대장균 발현 상위 BL21에서 검출 가능한 가용성 생성물을 수득되지 단백질의 생산을 위해 개발 BL21의 숙주 균주의 개선 돌연변이이다. SoluBL21 E.에서 Shadoo의 높은 수준의 표현 대장균 봉입체에서 단백질의 축적에 이르게. 비 - 천연 단백질은 E. 고도로 표현된다 일반적인 기능뿐만 대장균은,이 단백질은 불용성 봉입체에 축적되는 경향이있다. Shadoo 아마 여러도에 접힌 단백질에 의해 형성 고농축 동적 구조 비공유 소수성 또는 이온의 상호 작용 (또는이 둘의 조합)을 통해 집계합니다. (I) 변성 매체로부터 다른 생체 단백질의 선택적 분리, (ⅱ) 정제 된 단백질의 탈 변성 시험 관내 폴딩에 사용 : 결과적으로, 정제는 적어도 두 개의 단계를 포함기법. Shadoo의 선택적 분리는 8M 우레아 (또는 대안 6M 염산 구아니딘)를 함유하는 완충액에 달성되었다. (ⅰ) 탈 변성을 산성 pH의 용액에서 Shadoo의 중합을 수득하여 pH ≥의 용액 7 비정형 단량체 Shadoo 단백질, 또는 (ⅱ) 탈 변성을 얻었다 : 우레아 및 제거 단백질의 탈 변성은 다양한 프로토콜을 적용하여 수행 할 수있다 특성 크로스 - β 시트 모티브와 안정 아밀로이드 섬유로.

<table>
	<tbody>
		<tr>
			<td>AKTA FPLC&#160;</td>
			<td>GE, Amersham</td>
			<td># 1363</td>
			<td></td>
		</tr>
		<tr>
			<td>HiLoad 16/60 Superdex</td>
			<td>GE Healthcare</td>
			<td>17-1069-01</td>
			<td></td>
		</tr>
		<tr>
			<td>HiTrap IMAC</td>
			<td>GE Healthcare</td>
			<td>GE17-0920-05</td>
			<td></td>
		</tr>
		<tr>
			<td>HiPrep26/10 Desalting column</td>
			<td>GE Healthcare</td>
			<td>GE17-5087-01</td>
			<td></td>
		</tr>
		<tr>
			<td>SoluBL21 Competent E. coli</td>
			<td>Genlantis</td>
			<td>C700200</td>
			<td></td>
		</tr>
		<tr>
			<td>pET-28b+</td>
			<td>Novogen</td>
			<td>69865-3</td>
			<td></td>
		</tr>
		<tr>
			<td>IPTG</td>
			<td>Sigma-Aldrich</td>
			<td>I6758</td>
			<td></td>
		</tr>
		<tr>
			<td>LB-Broth medium</td>
			<td>Sigma-Aldrich</td>
			<td>L3022</td>
			<td></td>
		</tr>
		<tr>
			<td>Eppendorf Biophotometar</td>
			<td>Eppendorf</td>
			<td>550507804</td>
			<td></td>
		</tr>
		<tr>
			<td>Trito X-100</td>
			<td>Life Technologies</td>
			<td>85111</td>
			<td></td>
		</tr>
		<tr>
			<td>NiSO4</td>
			<td>Sigma-Aldrich</td>
			<td>656895</td>
			<td></td>
		</tr>
		<tr>
			<td>EDTA</td>
			<td>Sigma-Aldrich</td>
			<td>E6758</td>
			<td></td>
		</tr>
		<tr>
			<td>Tris-HCl</td>
			<td>Sigma-Aldrich</td>
			<td>RES3098T</td>
			<td></td>
		</tr>
		<tr>
			<td>Protease Inhibitor Cocktail Tablets</td>
			<td>Roche</td>
			<td>4693116001</td>
			<td></td>
		</tr>
		<tr>
			<td>NaCl</td>
			<td>Sigma-Aldrich</td>
			<td>746398</td>
			<td></td>
		</tr>
		<tr>
			<td>Imidazol</td>
			<td>Sigma-Aldrich</td>
			<td>I5513</td>
			<td></td>
		</tr>
		<tr>
			<td>Gdn-HCl</td>
			<td>Sigma-Aldrich</td>
			<td>G4505</td>
			<td></td>
		</tr>
		<tr>
			<td>protein size marker&#160;</td>
			<td>Thermo Fisher Scientific</td>
			<td>26620</td>
			<td></td>
		</tr>
	</tbody>
</table>

purification and refolding to amyloid fibrils of (his)6-tagged recombinant shadoo protein expressed as inclusion bodies in e. coli

대장균 발현 시스템은 재조합 진핵 단백질의 생산을위한 강력한 도구이다. 우리는 Shadoo, 프리온 가족에 속하는 단백질을 생산하기 위해 사용합니다. 봉입체 설명 된 바와 같이 (그의) 6 -tagged 재조합 Shadoo의 정제를위한 크로마토 그래피 방법을 표현했다. 봉입체는 8 M 유레아에 용해하고 이온 친 화성 크로마토 그래피를 수행하는 니켈 2+ -charged 칼럼에 결합된다. 결합 된 단백질은 이미 다졸 구배로 용출된다. Shadoo 단백질을 함유하는 분획을 고도로 정제 된 단백질을 수득하는 크기 배제 크로마토 그래피를 실시한다. 마지막 단계 정제 Shadoo에서 염, 우레아 및 이미 다졸을 제거하는 탈염된다. 재조합 Shadoo 단백질 프리온 질환에서 발생하는 단백질의 입체 장애의 생물 물리학 및 생화학 연구를위한 중요한 시약이다. 대부분의 보고서는 프리온 신경 퇴행성 질환이 자상의 증착에서 발생한 것을 증명제작은 아밀로이드 원 섬유를 주문했다. 산성 및 중성에서 아밀로이드 원 섬유로 Shadoo을 피 브릴하는 방법을 설명하는 샘플 프로토콜 / 기본 pH 값이 표시됩니다. 생산하고 신속하고 저렴한 비용으로 단백질의 대량 생산이 가능하기 때문에 Shadoo은, 프리온 질환에 작업 실험실에서 연구를 용이하게 할 수있다 피 브릴하는 방법에 대한 방법.

정제 Shadoo 단백질의 5-10 mg의 세균 배양 리터당 얻어진다. 두 단계의 정제는 고순도의 재조합 Shadoo을 구하는데 필요하다. 첫 번째 단계는 그의 - 태그 - 단백질을 유지하는 니켈 2 + -charged 컬럼 친 화성 크로마토 그래피에 의해 수행된다. 용출 분획을 SDS-PAGE를 실시하고 쿠마 브릴리언트 블루 (그림 5A)로 염색한다. Shadoo 단백질을 함유하는 분획을 모으고 또한 그 크기에 따라 분?...

Watch this Scientific Journal Video about Purification and Refolding to Amyloid Fibrils of His6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli at JoVE.com

Purification and Refolding to Amyloid Fibrils of His6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli

A two-step chromatographic method is described for the purification of recombinant Shadoo protein expressed as inclusion bodies in Escherichia coli, as well as a protocol to fibrillate purified Shadoo into amyloid structures.

정제 및 아밀로이드 피 브릴로 리 폴딩 (그의)<sub&gt; 6</sub&gt; -tagged 재조합 Shadoo 단백질의 봉입체로 표현<em&gt; 대장균</em

The Escherichia coli expression system is a powerful tool for the production of recombinant eukaryotic proteins. We use it to produce Shadoo, a protein ...

Research

JoVE Journal

Biology

Purification and Refolding to Amyloid Fibrils of (His)6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli

Patch Clamp Recording of Ion Channels Expressed in  Xenopus Oocytes

Xenopus Oocytes의 표현 이온 채널 패치 클램프 녹음

Since its development by Sakmann and Neher 1, 2, the patch clamp has become established as an extremely useful technique for electrophysiological ...

연구

생물학

Staining of Proteins in Gels with Coomassie G-250 without Organic Solvent and Acetic Acid

유기 용매 및 초산없이 쿠매시 G - 250로 젤의 단백질 염색법

In classical protein staining protocols using Coomassie Brilliant Blue (CBB), solutions with high contents of toxic and flammable organic solvents ...

Mutagenesis and Functional Selection Protocols for Directed Evolution of Proteins in E. coli

Mutagenesis and Functional Selection Protocols for Directed Evolution of Proteins in E. coli

에서 단백질의 감독 진화에 대한 돌연변이 유발 및 기능 선택 프로토콜 E. 대장균</em

The efficient generation of genetic diversity represents an invaluable molecular tool that can be used to label DNA synthesis, to create unique molecular ...

Purification of Hsp104, a Protein Disaggregase

Hsp104의 정화, 단백질 Disaggregase

Hsp104 is a hexameric AAA+ protein1 from yeast, which couples ATP hydrolysis to protein disaggregation2-10 (Fig. 1). This activity imparts two key ...

Identification of Protein Complexes in Escherichia coli using Sequential Peptide Affinity Purification in Combination with Tandem Mass Spectrometry

Identification of Protein Complexes in Escherichia coli using Sequential Peptide Affinity Purification in Combination with Tandem Mass Spectrometry

의 단백질 단지의 식별<em&gt; 대장균</em&gt; 직렬 질량 분석법과 함께 순차적 펩타이드의 동질 정화를 사용하여

Since most cellular processes are mediated by macromolecular assemblies, the systematic identification of protein-protein interactions (PPI) and the ...

Coupled Assays for Monitoring Protein Refolding in Saccharomyces cerevisiae

Coupled Assays for Monitoring Protein Refolding in Saccharomyces cerevisiae

의 모니터링 단백질 접힘에 대한 결합 분석 실험<em&gt; 사카 cerevisiae의</em

Proteostasis, defined as the combined processes of protein folding/biogenesis, refolding/repair, and degradation, is a delicate cellular balance that must ...

Purification of the Cystic Fibrosis Transmembrane Conductance Regulator Protein Expressed in Saccharomyces cerevisiae

Purification of the Cystic Fibrosis Transmembrane Conductance Regulator Protein Expressed in Saccharomyces cerevisiae

로 표현 낭포 성 섬유증 막 횡단 전도력 규칙 단백질의 정제<em&gt; 사카로 마이 세스 세레 비시 애</em

Defects in the cystic fibrosis transmembrane conductance regulator (CFTR) protein cause cystic fibrosis (CF), an autosomal recessive disease that ...

High Throughput Quantitative Expression Screening and Purification Applied to Recombinant Disulfide-rich Venom Proteins Produced in E. coli

High Throughput Quantitative Expression Screening and Purification Applied to Recombinant Disulfide-rich Venom Proteins Produced in E. coli

에서 생산 재조합 이황화 풍부한 독 단백질에 적용되는 높은 처리량 정량 식 검사 및 정화<em&gt; E. 대장균</em

Escherichia coli (E. coli) is the most widely used expression system for the production of recombinant proteins for structural and functional studies. ...

Non-chromatographic Purification of Recombinant Elastin-like Polypeptides and their Fusions with Peptides and Proteins from Escherichia coli

Non-chromatographic Purification of Recombinant Elastin-like Polypeptides and their Fusions with Peptides and Proteins from Escherichia coli

에서 펩타이드 및 단백질과 재조합 엘라스틴 같은 폴리 펩타이드 및 그 융해의 비 크로마토 그래피 정제<em&gt; 대장균</em

Elastin-like polypeptides are repetitive biopolymers that exhibit a lower critical solution temperature phase transition behavior, existing as soluble ...

Green Fluorescent Protein-based Expression Screening of Membrane Proteins in Escherichia coli

Green Fluorescent Protein-based Expression Screening of Membrane Proteins in Escherichia coli

막 단백질의 녹색 형광 단백질 기반의 표현 상영에<em&gt; 대장균</em

The production of recombinant membrane proteins for structural and functional studies remains technically challenging due to low levels of expression and ...