وأيد أعمال البحث التي أجريت في المختبر من المنح المقدمة من مؤسسة أبحاث - فلاندرز (FWO؛ أرقام منحة G.0545.08 وG.0298.11)، وبين الجامعات الجذب برنامج البولنديين (سياسة العلوم البلجيكي؛ منح عدد P6/28 وP7/13) ومضمن في الأوساط البحثية FWO المدعومة. CDH هو زميل ما بعد الدكتوراه من مؤسسة البحوث - فلاندرز (FWO). المؤلفون ممتنون جدا لجميع الأعضاء الحاليين والسابقين في مختبر الجزيئية والخلوية اشارة (جامعة لوفين الكاثوليكية)، د. SP سرينيفاس (مدرسة جامعة إنديانا في علم البصريات، الولايات المتحدة الأمريكية)، ومختبر الدكتور Leybaert (جامعة غنت) ولل د. Vinken (VUB) الذين قدموا مناقشات مفيدة، إلى أقصى حد أو الإجراءات شاركوا في تطوير أدوات لدراسة hemichannels connexin.

1. عزل الخلايا البطانية القرنية قبل الشروع في العمل: عزل الخلايا من العيون العذبة، التي تم الحصول عليها من مسلخ المحلية، في أقرب وقت ممكن بعد enucleating العين. تأكد من أن العين كانت منزوعة النواة من بقرة القصوى 18 شهرا من العمر، خمس دقائق بعد الوفاة والحفاظ عليها في محلول الملح المتوازن ايرل - 1٪ محلول اليود عند 4 درجة مئوية لمدة النقل إلى المختبر. <ol style=";text-align:right;direction:rtl"><li style=";text-align:right;direction:rtl"> تأخذ العين من محلول الملح المتوازن وايرل - 1٪ محلول اليود ووضعه في طبق بيتري (100 × 20 مم). </li><li style=";text-align:right;direction:rtl"> تعقيم العين مع محلول يحتوي على 70٪ من الإيثانول وشطف مع محلول الملح المتوازن ايرل تحتوي على 1٪ اليود. </li><li style=";text-align:right;direction:rtl"> من هذه الخطوة على، والعمل في غطاء العقيمة. تشريح بعناية القرنية من العين ووضعه في طبق بتري (35 × 10 مم) التي تحتوي على محلول الملح المتوازن ايرل، مع طبقة الخلايا الظهارية التي تواجه التصاعدي. بعناية إزالة أي قزحية STI الأنسجة المتبقيةليرة لبنانية تعلق على القرنية إذا لزم الأمر. </li><li style=";text-align:right;direction:rtl"> نقل القرنية لمحلول الملح المتوازن ايرل آخر تحتوي على طبق بيتري مع طبقة الخلايا البطانية التصاعدي وشطف مرتين مع محلول الملح المتوازن ايرل. </li><li style=";text-align:right;direction:rtl"> نقل القرنية مع الطبقة البطانية التي تواجه التصاعدي إلى الرملية، وهو طبق على شكل كوب، وتغطية ذلك مع متوسط ​​النمو. يتكون المتوسطة نمو متوسطة Dulbecco في التعديل النسر يحتوي على 25 الجلوكوز ملي، و 10٪ مصل بقري جنيني، 6.6٪ L-الجلوتامين، 2.5 ميكروغرام / مل الأمفوتريسين-B، و 1٪ خليط مضاد حيوي مضاد فطري تحتوي على 10،000 وحدة / مل من البنسلين، 10،000 ميكروغرام / مل من الستربتوميسين، و 25 ميكروغرام / مل الأمفوتريسين B. </li><li style=";text-align:right;direction:rtl"> إزالة المتوسطة مع ماصة الشفط. </li><li style=";text-align:right;direction:rtl"> تطبيق 300 ميكرولتر من محلول التربسين (0.5 غرام / لتر) إلى الطبقة البطانية للقرنية (يتم الانتهاء من جميع الخطوات التي تشمل التربسين باستخدام نفس التركيز). </li><li style=";text-align:right;direction:rtl"> وضع الساعة الرملية التي تحتوي على القرنية في طبق بيتري تغطيتها ووضعها في المؤتمر الوطني العراقيubator لمدة 30 دقيقة عند 37 درجة مئوية و 5٪ CO 2. </li><li style=";text-align:right;direction:rtl"> كشط بلطف الخلايا البطانية بعيدا عن القرنية مع مصقول النار هوك على شكل الزجاج ماصة باستير في غطاء العقيمة. </li><li style=";text-align:right;direction:rtl"> تمتص قبالة محلول يحتوي على الخلايا البطانية وإضافته إلى قوارير الثقافة (25 سم 2) تحتوي على 4 مل من مستنبت. </li><li style=";text-align:right;direction:rtl"> تطبيق 300 ميكرولتر من متوسط ​​النمو إلى القرنية وتكرار تجريف وإضافة محلول يحتوي على الخلايا البطانية للقارورة الثقافة. </li><li style=";text-align:right;direction:rtl"> كرر هذه الخطوة الأخيرة (1.11) مرة أخرى. </li><li style=";text-align:right;direction:rtl"> وضع الثقافة قوارير تحتوي على الخلايا البطانية القرنية في متوسط ​​النمو في الحاضنة عند 37 درجة مئوية و 5٪ CO 2. </li><li style=";text-align:right;direction:rtl"> بعد يومين، إضافة 6 مل من مستنبت. </li><li style=";text-align:right;direction:rtl"> تحديث المتوسطة النمو كل يوم الثاني. </li></ol> 2. الثقافة الخلية <ol style=";text-align:right;direction:rtl"><li style=";text-align:right;direction:rtl"> إزالة مستنبت وغسل الخلايا مرتين مع محلول الملح المتوازن ايرل، وعندما يتم التوصل confluency (داخل ابوT 10 أيام بعد العزلة). </li><li style=";text-align:right;direction:rtl"> إضافة 1.5 مل من محلول التربسين إلى الخلايا لفصل بينها ووضع القارورة في الحاضنة (37 درجة مئوية، 5٪ CO 2) لمدة 3 إلى 4 دقائق. </li><li style=";text-align:right;direction:rtl"> إضافة 12 مل من وسط النمو. ماصة متوسطة ثلاث مرات الدخول والخروج لتفريق الخلايا وعدد الخلايا. </li><li style=";text-align:right;direction:rtl"> بذور الخلايا مع جزء متغير تبعا لكثافة الخلايا ووضعها في الحاضنة. إعداد شريحتين جيدا حجرات (بمساحة 4.2 سم 2) مع عدد خلايا من خلايا 165،000 (39،286 كثافة الخلايا لكل سم 2). إعداد 80 سم 2 قوارير الثقافة لمرور جديدة في مناطق ذات كثافة من 6،250 لكل سم 2، وإضافة مستنبت الطازجة تصل إلى وحدة تخزين ما مجموعه 25 مل. </li><li style=";text-align:right;direction:rtl"> تحديث المتوسطة كل يومين. </li><li style=";text-align:right;direction:rtl"> يتم التوصل Confluency من طبقة الخلايا بعد 3 إلى 4 أيام. استخدام الخلايا لإجراء التجارب. </li><li style=";text-align:right;direction:rtl"> عندما يتم التوصل confluency من طبقة الخلايا في قوارير، كرر الخطوات من 2،1-2،6. مزارع الخلايا يصل إلى مرور 2 يمكن استخدامها جمعةأو التجارب. </li></ol> 3. التحفيز الميكانيكي لإحداث موجة الكالسيوم <ol style=";text-align:right;direction:rtl"><li style=";text-align:right;direction:rtl"> تحميل الخلايا في الشريحة حجرات مع 10 ميكرومتر فلوو-4 صباحا في الفوسفات مخزنة المالحة لمدة 30 دقيقة عند 37 درجة مئوية في حين تهز بلطف. </li><li style=";text-align:right;direction:rtl"> إزالة فلوو-04:00 حل، وغسل الخلايا خمس مرات مع الفوسفات مخزنة المالحة، احتضان الخلايا مع الفوسفات مخزنة المالحة وترك الخلايا لمدة لا تقل عن 5 دقائق في درجة حرارة الغرفة قبل القياس. </li><li style=";text-align:right;direction:rtl"> تثير في 488 نانومتر مع الأرجون ليزر واستخدام شعاع الخائن HFT 488، وجمع الانبعاثات مضان في 530 نانومتر باستخدام longpass الانبعاثات مرشح LP 505، تعيين الثقب في الحد الأدنى. استخدام الغمر 40X الهدف النفط (هواء، 1.2 NA). في التجارب مع ARL-67156، واستخدام الهدف 10X (هواء، 0.3 NA). </li><li style=";text-align:right;direction:rtl"> بحث عن حقل في الخلايا التي هي متكدسة على المجهر متحد البؤر. </li><li style=";text-align:right;direction:rtl"> موقف ماصة بحيث يكون في 45 درجة فيما يتعلق الشريحة حجرات ولمس غشاء الخلية.إثارة (≈ 1 ثانية) التحفيز الميكانيكي قصيرة إلى خلية واحدة. يتكون التحفيز الميكانيكي ل، تشوه قصيرة الأمد الحاد للخلية عن طريق لمس لفترة وجيزة أقل من 1٪ من غشاء الخلية مع micropipette الزجاج (قطر الحافة &lt;1 ميكرون) بالإضافة إلى nanopositioner الكريستال كهرضغطية، تعمل من خلال مكبر للصوت الذي هو شنت على الصغرى مناور. مصنوعة بال micropipettes الزجاج مع ساحبة مسرى مكروي. تأكد من أن nanopositioner تشغلها الجهد بين 0.2 و 1.5 V خلال التحفيز الميكانيكي. A الجهد أعلى من 1.5 V يمكن أن يؤدي إلى تلف الخلايا. لكل نوع من الخلايا وحالة، والجهد الأمثل لتحفيز الميكانيكية دون تلف الخلايا يجب أن تحدد بعناية من خلال تطبيق سلسلة من الفولتية المنخفضة بدءا من (0.2 V) على ارتفاع (1.5 V) الجهد. الجهد هو مقياس لقوة من التحفيز منذ هذا الجهد يحدد إجهاد والتوتر التي يتم تطبيقها على غشاء الخلية. الويمكن حساب قوة من التحفيز الميكانيكي عن طريق ضرب إجهاد ميكانيكي مع المنطقة. نظرا لأن كلا من منطقة (&lt;3.14 ميكرون 2) والضغط الميكانيكية هي منخفضة جدا، وقوة من التحفيز الميكانيكي منخفضة. (لاحظ أنه عند تلف خلية، التسريبات مضان الخروج من الخلية والخلية يتحول الظلام.) </li><li style=";text-align:right;direction:rtl"> قياس التغيرات المكانية في [كا 2 +] ط أعقاب التحفيز الميكانيكي مع المجهر متحد البؤر. </li><li style=";text-align:right;direction:rtl"> جمع وتخزين الصور. </li><li style=";text-align:right;direction:rtl"> رسم المنطقة المضلعة من مصلحة لتحديد مساحة السطح الكلي للخلايا مستجيبة (منطقة نشطة، AA) باستخدام البرنامج من المجهر متحد البؤر. </li></ol>

الكتاب ليس لديهم ما يكشف.

في هذا المخطوط، ونحن تصف طريقة بسيطة لقياس بين الخلايا كا 2 + انتشار الموجة في الطبقات الوحيدة من الأبقار الخلايا البطانية القرنية الأولية عن طريق توفير التحفيز الميكانيكي المترجمة والتي تسيطر عليها باستخدام micropipette. الخلايا حفز ميكانيكيا الاستجابة مع زيادة ال...

الاتصالات بين الخلايا وإشارات ضرورية لتنسيق العمليات الفسيولوجية في استجابة لمنبهات خارج الخلية في الأنسجة و1،2 مستوى كامل الجهاز. يتم إنشاء الطريق الأكثر مباشرة للاتصال بين الخلايا من حدوث تقاطعات الفجوة. تقاطعات الفجوة هي لويحات من القنوات تقاطع الفجوة، والتي هي القنوات البروتينية التي شكلتها لرسو السفن وجها لوجه من اثنين connexin (CX) hemichannels من الخلايا المتجاورة 3،4 (الشكل 1). تقاطعات الفجوة تسمح بمرور الجزيئات الصغيرة إشارة ذات وزن جزيئي أقل من 1.5 كيلو دالتون، بما في ذلك كا 2 + 3 5 أو IP، مما تسبب في وتحوير كا 2 + الإفراج من المخازن داخل الخلايا من الخلايا المجاورة 6 (الشكل 2). قنوات تقاطع الفجوة وينظم بإحكام بواسطة البينية بين الجزيئات والتفاعلات البروتين والعمليات مما يشير الخلوية، مثل تعديل الأكسدة والفسفرة 7. GJS تسهيل الاستجابة المنسقة من الخلايا متصلة، فيعمل كمادة كيميائية ومخلى الكهربائية. على سبيل المثال، انتشار إمكانات العمل القلب عبر myocytes الأذيني البطيني ويتم بوساطة قنوات GJ المستندة إلى معادل 85. CXS يكن لديك سوى دور كقنوات تقاطع الفجوة، ولكن أيضا تشكيل hemichannels المفردة، وبالتالي تعمل كقنوات في الأغشية على نحو مماثل لقنوات ايون العادية 8-10 (الشكل 1). المشاركة Hemichannels في إشارة نظير الصماوي بين الخلايا المجاورة عن طريق التحكم في تبادل الأيونات والجزيئات يشير بين البيئة داخل وخارج الخلية. في العديد من أنواع الخلايا (مثل الخلايا الظهارية وخلايا بانية للعظم، الخلايا النجمية والخلايا البطانية، وغيرها) وأجهزة (مثل الدماغ والكبد وشبكية العين، القوقعة والأوعية الدموية)، بين الخلايا كا 2 + موجات أساسية لتنسيق الاستجابات المتعددة الخلايا <suP&gt; 11. الزيادات في داخل الخلايا كا 2 + المستويات في خلية معينة لا تقتصر على هذه الخلية، ولكن تنتشر إلى الخلايا المجاورة المحيطة بها، وبالتالي إنشاء الكالسيوم بين الخلايا 2 + الموجة 12،13. هذه بين الخلايا كا 2 + موجات مهمة لتنظيم فسيولوجية طبيعية من طبقات الخلايا باعتبارها مخلى وارتبط التقلبات مع العمليات الفيزيولوجية المرضية 11. في بطانة القرنية وظهارة، مجموعات مختلفة 14-24، بما في ذلك منطقتنا 25-33، ودرس آليات وأدوار الاتصالات بين الخلايا. في الخلايا غير منفعل، مثل الخلايا البطانية القرنية، واثنين من وسائط مختلفة من الاتصالات بين الخلايا تحدث 28،29، وهي فجوة التواصل بين الخلايا صلي والاتصالات بين الخلايا نظير الصماوي. ينطوي على فجوة الاتصال بين الخلايا صلي على التبادل المباشر للجزيئات إشارة عبر الفجوة التقاطعات 7. الفجوة و Juncالاتصالات بين الخلايا tional أمر بالغ الأهمية للحفاظ على توازن الأنسجة، والسيطرة على تكاثر الخلايا، وإنشاء استجابة المتزامنة للإجهاد خارج الخلية 10،34،35. في عدد من الحالات المرضية، يتم تقليل الفجوة اقتران تقاطع بسبب CXS المعيبة، والتي تؤثر بهذا الفجوة صلي الاتصالات بين الخلايا 36. وهذا يؤكد أهمية وتأثير فجوة الاتصال بين الخلايا صلي في الكائنات متعددة الخلايا. وعلى النقيض من فجوة الاتصال بين الخلايا صلي والاتصالات بين الخلايا نظير الصماوي ليست متوقفة على بدل خلية خلية، لأنه ينطوي على الافراج عن رسل خارج الخلية إنتشاري (الشكل 2). يتم إطلاق أنواع مختلفة من الجزيئات يشير في الفضاء خارج الخلية عن طريق إشارات الخلايا. ثم يتم نقل جزيء إلى الخلية المستهدفة حيث يتم الكشف عنها بواسطة بروتين مستقبلات محددة. وفي وقت لاحق مجمع مستقبلات إشارة يؤدي الى استجابة الخلوية، التييتم إنهاء عن طريق إزالة إشارة، تعطيل أو إزالة التحسس. صدر محبة للدهون رسل إشارة خارج الخلية اختراق الغشاء وتعمل على مستقبلات الخلايا. في المقابل، رسل ماء لا عبور الغشاء البلازمي للخلية الاستجابة، ولكن بمثابة يجند التي تربط لسطح أعرب البروتينات المستقبلة، التي تتابع بعد ذلك إشارة إلى البيئة داخل الخلايا. ثلاث عائلات رئيسية من البروتينات مستقبلات سطح الخلية المشاركة في هذه العملية: ايون قناة مرتبطة، المرتبط بالإنزيم، وربط بروتين G. الجزيء رسول صدر يمكن أن تعمل على المستقبلات من نفس الخلية (autocrine)، على الخلايا المستهدفة على مقربة (نظير الصماوي)، أو على الخلايا المستهدفة البعيدة التي تتطلب نظام الدورة الدموية (الغدد الصماء). في العديد من أنواع الخلايا، بما في ذلك بطانة القرنية 28،29، ATP هو واحد من عوامل نظير الصماوي ماء الرئيسية التي تدفع انتشار بين الخلايا كا 2 + موجات 37-40. الدرجي تشوه الميكانيكية، نقص الأكسجة، التهاب أو التحفيز من قبل وكلاء مختلف، ATP يمكن أن تنطلق من الخلايا السليمة 41-44 استجابة لإجهاد القص، وتمتد، أو ناضح تورم 44،45. وقد افترض آليات ATP-الافراج مختلفة، بما في ذلك إيماس حويصلي 44 وعدد كبير من آليات النقل، مثل راديو كاسيت ATP ملزم (ABC) الناقلون، قنوات أنيون التي تعتمد على الجهد البلازمي 46، P2X7 قنوات مستقبلات 47،48، وكذلك hemichannels connexin 49-52 وhemichannels pannexin 43،49،53. ATP خارج الخلية يمكن ان تحلل بسرعة إلى ADP، AMP والأدينوساين 54،55 من قبل ectonucleotidases التي تكون موجودة في البيئة خارج الخلية. سوف ATP صدر خارج الخلية والمستقلب ADP 56 ينتشر عن طريق نشرها. وقد تورط التفاعل اللاحقة من هذه النيوكليوتيدات مع مستقبلات purinergic في الخلايا المجاورة في عropagation من بين الخلايا كا 2 + موجات 28،37،51. فئتين مختلفتين من المستقبلات purinergic موجودة: الأدينوزين هو يجند الطبيعية الرئيسية لP1-purinoceptors، في حين أن كلا البيورين (ATP، ADP) وبيريميدين (UTP، UDP) النيوكليوتيدات تعمل على معظم P2-purinoceptors 57. الاتصالات بين الخلايا يمكن التحقيق من قبل وسائل مختلفة مثل تحميل كشط، ونقل صبغ، uncaging المحلية من منبهات مثل IP 3 والكالسيوم 2 +، التحفيز الميكانيكي، الخ. نحن هنا وصف دراسة كا 2 + موجة الانتشار التي تسببها التحفيز الميكانيكي من خلية واحدة. الاستفادة من دراسة كا 2 + انتشار الموجة عن طريق التحفيز الميكانيكي هو أنه يوفر أداة سهلة لقياس انتشار كا 2 + الموجة مع مرور الوقت وأنه يسمح بمقارنة كميا المعالجة المسبقة مختلفة من الخلايا. في بطانة القرنية، وهذه كا 2 + بين الخلايا موجات تسمح لشركةاستجابة منسقة من أحادي الطبقة، وهو يتصرف بموجب كآلية دفاع ممكن من بطانة القرنية غير التجدد مساعدة البطانة على تحمل الضغوط خارج الخلية أثناء الجراحة داخل العين، أو عند التعرض للالتهابات وسطاء خلال الرفض المناعي أو التهاب القزحية 58،59.

<table border="1">
<tbody>
 <tr>
 <td>Name of Reagent/Material</td>
 <td>Company</td>
 <td>Catalog Number</td>
 <td>Column1</td>
 </tr>
 <tr>
 <td>Earle's Balanced Salt Solution (EBSS)</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>14155-048</td>
 <td></td>
 </tr>
 <tr>
 <td>Iodine</td>
 <td>Sigma-Aldrich (Deisenhofen, Germany)</td>
 <td>38060-1EA</td>
 <td></td>
 </tr>
 <tr>
 <td>Dulbecco's Modified Eagle's Medium (DMEM)</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>11960-044</td>
 <td></td>
 </tr>
 <tr>
 <td>L-glutamine (Glutamax)</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>35050-038</td>
 <td></td>
 </tr>
 <tr>
 <td>Amphotericin-B</td>
 <td>Sigma-Aldrich (Deisenhofen, Germany)</td>
 <td>A2942</td>
 <td></td>
 </tr>
 <tr>
 <td>Antibiotic-antimycotic mixture</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>15240-096</td>
 <td></td>
 </tr>
 <tr>
 <td>Trypsin</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>25300-054</td>
 <td></td>
 </tr>
 <tr>
 <td>Dulbecco's PBS</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>14190-091</td>
 <td></td>
 </tr>
 <tr>
 <td>Fluo-4 AM</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>F14217</td>
 <td></td>
 </tr>
 <tr>
 <td>ARL-67156 (6-N,N-Diethyl-b,g-dibromomethylene-D-ATP) </td>
 <td>Sigma-Aldrich (Deisenhofen, Germany)</td>
 <td>A265</td>
 <td></td>
 </tr>
 <tr>
 <td>Apyrase VI</td>
 <td>Sigma-Aldrich (Deisenhofen, Germany)</td>
 <td>A6410</td>
 <td></td>
 </tr>
 <tr>
 <td>Apyrase VII</td>
 <td>Sigma-Aldrich (Deisenhofen, Germany)</td>
 <td>A6535</td>
 <td></td>
 </tr>
 <tr>
 <td>Gap26 (VCYDKSFPISHVR)</td>
 <td>Custom peptide synthesis</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>Gap27 (SRPTEKTIFII)</td>
 <td>Custom peptide synthesis</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>Control Peptide (SRGGEKNVFIV)</td>
 <td>Custom peptide synthesis</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>siRNA1 Cx43 (sense: 5'GAAGGAGGAGGAACU-CAAAdTdT) </td>
 <td>Annealed siRNA was purchased at Eurogentec (Luik, Belgium)</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>siRNA2 Cx43 (sense: 5'CAAUUCUUCCUGCCGCAAUdTdT) </td>
 <td>Annealed siRNA was purchased at Eurogentec (Luik, Belgium)</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>siRNA scramble: scrambled sequence of siCx43-1 (sense: 5'GGUAAACG-GAACGAGAAGAdTdT) </td>
 <td>Annealed siRNA was purchased at Eurogentec (Luik, Belgium)</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>TAT-L2 (TAT- DGANVDMHLKQIEIKKFKYGIEEHGK)</td>
 <td>Thermo Electron (Ulm, Germany)</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>TAT-L2-H126K/I130N (TAT-DGANVDMKLKQNEIKKFKYGIEEHGK) </td>
 <td>Thermo Electron (Ulm, Germany)</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td></td>
 <td></td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>Two chambered glass slides</td>
 <td>Laboratory-Tek Nunc (Roskilde, Denmark)</td>
 <td>155380</td>
 <td></td>
 </tr>
 <tr>
 <td>Confocal microscope </td>
 <td>Carl Zeiss Meditec (Jena, Germany)</td>
 <td>LSM510</td>
 <td></td>
 </tr>
 <tr>
 <td>Piezoelectric crystal nanopositioner (Piezo Flexure NanoPositioner)</td>
 <td>PI Polytech (Karlsruhe, Germany)</td>
 <td>P-280</td>
 <td></td>
 </tr>
 <tr>
 <td>HVPZT-amplifier</td>
 <td>PI Polytech (Karlsruhe, Germany)</td>
 <td>E463 HVPZT-amplifier</td>
 <td></td>
 </tr>
 <tr>
 <td>Glass tubes (glass replacement 3.5 nanoliter)</td>
 <td>World Precision Instruments, Inc. Sarasota, Florida, USA</td>
 <td>4878</td>
 <td></td>
 </tr>
 <tr>
 <td>Microelectrode puller </td>
 <td>Zeitz Instrumente (Munchen, Germany)</td>
 <td>WZ DMZ-Universal Puller</td>
 <td></td>
 </tr>
</tbody>
 </table>

mechanical stimulation-induced calcium wave propagation in cell monolayers: the example of bovine corneal endothelial cells

الاتصالات بين الخلايا أمر ضروري لتنسيق العمليات الفسيولوجية بين الخلايا في مجموعة متنوعة من الأجهزة والأنسجة، بما في ذلك الدماغ والكبد، شبكية العين، القوقعة والأوعية الدموية. في إعدادات التجريبية، بين الخلايا كا 2 + موجات يمكن استخلاصها من خلال تطبيق التحفيز الميكانيكي لخلية واحدة. وهذا يؤدي إلى الإفراج عن الجزيئات داخل الخلايا مما يشير IP 3 والكالسيوم 2 + التي بدء انتشار كا 2 + الموجة بتكثف من الخلية حفز ميكانيكيا إلى الخلايا المجاورة. يتم توفير المسارات الجزيئية الرئيسية التي تتحكم بين الخلايا كا 2 + انتشار الموجة عبر قنوات تقاطع الفجوة من خلال نقل مباشر من IP (3) وhemichannels من خلال الافراج عن ATP. ويسمح تحديد وتوصيف خصائص وتنظيم connexin مختلفة والأشكال الإسوية pannexin كقنوات تقاطع الفجوة وhemichannels من قبل quantificatioن من انتشار الكالسيوم بين الخلايا 2 + الموجة، سيرنا، واستخدام مثبطات قنوات تقاطع الفجوة وhemichannels. هنا، نحن تصف طريقة لقياس بين الخلايا كا 2 + الموجة في الطبقات الوحيدة من الخلايا البطانية القرنية الأولية محملة Fluo4-AM ردا على التحفيز الميكانيكي للرقابة والمترجمة استفزاز من قبل، وتشوه قصيرة الأمد الحاد في الخلية نتيجة لذلك من لمس غشاء الخلية مع micropipette الزجاج التي تسيطر عليها مياداة مجهرية التي يبلغ قطرها غيض من أقل من 1 ميكرون. نحن أيضا وصف عزلة الابتدائي الأبقار الخلايا البطانية القرنية واستخدامه كنظام نموذج لتقييم النشاط Cx43-hemichannel باعتبارها القوة يحركها لبين الخلايا كا 2 + موجات من خلال الافراج عن ATP. وأخيرا، نحن مناقشة استخدام، ومزايا والقيود والبدائل لهذا الأسلوب في سياق الفجوة قناة تقاطع والبحوث hemichannel.

يتم تنفيذ جميع التجارب في الامتثال لجميع المبادئ التوجيهية واللوائح والوكالات التنظيمية ذات الصلة، ويتم تنفيذ بروتوكول يتم شرحها تحت إشراف وموافقة ورعاية الحيوان واللجنة الاستخدام من جامعة لوفين الكاثوليكية. في الأبقار الخلا?...

Watch this Scientific Journal Video about Mechanical Stimulation-induced Calcium Wave Propagation in Cell Monolayers: The Example of Bovine Corneal Endothelial Cells at JoVE.com

Mechanical Stimulation-induced Calcium Wave Propagation in Cell Monolayers: The Example of Bovine Corneal Endothelial Cells

الكالسيوم بين الخلايا<sup&gt; 2 +</supهي التي تحرك&gt; موجات عبر قنوات تقاطع الفجوة وhemichannels. هنا، نحن تصف طريقة لقياس الكالسيوم بين الخلايا<sup&gt; 2 +</sup&gt; موجات في الخلية monolayers في استجابة لحافز الميكانيكية وحيدة الخلية المحلية وتطبيقه على التحقيق في خصائص وتنظيم قنوات تقاطع الفجوة وhemichannels.

تحفيز الميكانيكية التي يسببها الكالسيوم انتشار الموجات في الخلية monolayers: مثال من الأبقار الخلايا البطانية القرنية

Intercellular communication is essential for the coordination of physiological processes between cells in a variety of organs and tissues, including the ...

mechanical-stimulation-induced-calcium-wave-propagation-cell

Research

JoVE Journal

Biology

16.2K Views.  KU Leuven. الكالسيوم بين الخلايا 2 + موجات عبر قنوات تقاطع الفجوة وhemichannels. هنا، نحن تصف طريقة لقياس الكالسيوم بين الخلايا 2 + موجات في الخلية monolayers في استجابة لحافز الميكانيكية وحيدة الخلية المحلية وتطبيقه على التحقيق في خصائص وتنظيم قنوات تقا...

Video: Mechanical Stimulation-induced Calcium Wave Propagation in Cell Monolayers: The Example of Bovine Corneal Endothelial Cells

Propagation of Human Embryonic Stem (ES) Cells

Propagation of Human Embryonic Stem ES Cells

انتشار الخلايا الجنينية البشرية (ES) الجذعية

Isolation and Large Scale Expansion of Adult Human Endothelial Colony Forming Progenitor Cells

This paper introduces a novel recovery strategy for endothelial colony forming progenitor cells (ECFCs) from heparinized but otherwise unmanipulated adult human peripheral blood within a mean of 12 days. After large scale expansion &gt;1x108 ECFCs can be obtained for further tests. Advantageously by using pHPL the contact of human cells with bovine serum antigens can be excluded. By flow cytometry and immunohistochemistry the isolated cells can be characterized as ECFC and their in vitro functionality to form vascular like structures can be tested in a matrigel assay. Further these cells can be subcutaneously injected in a mouse model to form functional, perfused vessels in vivo. After long term expansion and cryopreservation proliferation, function and genomic stability appear to be preserved. 3,4
This animal-protein free isolation and expansion method is easily applicable to generate a large quantity of ECFCs.

Endothelial colony forming progenitor cells (ECFCs) are a promising tool to study vascular homeostasis and repair.1,2 This paper introduces a novel animal-serum free method for isolation and expansion of ECFC from heparinised adult human peripheral blood with pooled human platelet lysate (pHPL) diminishing the risk of anti-bovine immunisation.

العزلة وتوقعات بنمو كبير من الكبار الإنسان خلايا غشائي السلف تشكيل مستعمرة

This paper introduces a novel recovery strategy for endothelial colony forming progenitor cells (ECFCs) from heparinized but otherwise unmanipulated adult ...

Study of the Actin Cytoskeleton in Live Endothelial Cells Expressing GFP-Actin

The microvascular endothelium plays an important role as a selectively permeable barrier to fluids and solutes. The adhesive junctions between endothelial cells regulate permeability of the endothelium, and many studies have indicated the important contribution of the actin cytoskeleton to determining junctional integrity1-5. A cortical actin belt is thought to be important for the maintenance of stable junctions1, 2, 4, 5. In contrast, actin stress fibers are thought to generate centripetal tension within endothelial cells that weakens junctions2-5. Much of this theory has been based on studies in which endothelial cells are treated with inflammatory mediators known to increase endothelial permeability, and then fixing the cells and labeling F-actin for microscopic observation. However, these studies provide a very limited understanding of the role of the actin cytoskeleton because images of fixed cells provide only snapshots in time with no information about the dynamics of actin structures5. 
Live-cell imaging allows incorporation of the dynamic nature of the actin cytoskeleton into the studies of the mechanisms determining endothelial barrier integrity. A major advantage of this method is that the impact of various inflammatory stimuli on actin structures in endothelial cells can be assessed in the same set of living cells before and after treatment, removing potential bias that may occur when observing fixed specimens. Human umbilical vein endothelial cells (HUVEC) are transfected with a GFP-&beta;-actin plasmid and grown to confluence on glass coverslips. Time-lapse images of GFP-actin in confluent HUVEC are captured before and after the addition of inflammatory mediators that elicit time-dependent changes in endothelial barrier integrity. These studies enable visual observation of the fluid sequence of changes in the actin cytoskeleton that contribute to endothelial barrier disruption and restoration. 
Our results consistently show local, actin-rich lamellipodia formation and turnover in endothelial cells. The formation and movement of actin stress fibers can also be observed. An analysis of the frequency of formation and turnover of the local lamellipodia, before and after treatment with inflammatory stimuli can be documented by kymograph analyses. These studies provide important information on the dynamic nature of the actin cytoskeleton in endothelial cells that can used to discover previously unidentified molecular mechanisms important for the maintenance of endothelial barrier integrity.

Microscopic imaging of live endothelial cells expressing GFP-actin allows characterization of dynamic changes in cytoskeletal structures. Unlike techniques that use fixed specimens, this method provides a detailed assessment of temporal changes in the actin cytoskeleton in the same cells before, during, and after various physical, pharmacological, or inflammatory stimuli.

دراسة الهيكل الخلوي أكتين في الخلايا البطانية لايف تعرب عن GFP - أكتين

The microvascular endothelium plays an important role as a selectively permeable barrier to fluids and solutes. The adhesive junctions between endothelial ...

Preparation of Pancreatic Acinar Cells for the Purpose of Calcium Imaging, Cell Injury Measurements, and Adenoviral Infection

The pancreatic acinar cell is the main parenchymal cell of the exocrine pancreas and plays a primary role in the secretion of pancreatic enzymes into the pancreatic duct. It is also the site for the initiation of pancreatitis. Here we describe how acinar cells are isolated from whole pancreas tissue and intracellular calcium signals are measured. In addition, we describe the techniques of transfecting these cells with adenoviral constructs, and subsequently measuring the leakage of lactate dehydrogenase, a marker of cell injury, during conditions that induce acinar cell injury in vitro. These techniques provide a powerful tool to characterize acinar cell physiology and pathology.

We describe a reproducible method of preparing mouse pancreatic acinar cells from a mouse for the purpose of examining acinar cell calcium signals and cellular injury with physiologically and pathologically relevant stimuli. A method for adenoviral infection of these cells is also provided.

إعداد خلايا البنكرياس عنيبية لغرض التصوير الكالسيوم، القياسات إصابة الخلية، وعدوى الفيروسة الغدانية

The pancreatic acinar  cell is the main parenchymal cell of the exocrine pancreas and plays a primary  role in the secretion of pancreatic enzymes into ...

Assessment of Calcium Sparks in Intact Skeletal Muscle Fibers

Maintaining homeostatic Ca2+ signaling is a fundamental physiological process in living cells. Ca2+ sparks are the elementary units of Ca2+ signaling in the striated muscle fibers that appear as highly localized Ca2+ release events mediated by ryanodine receptor (RyR) Ca2+ release channels on the sarcoplasmic reticulum (SR) membrane. Proper assessment of muscle Ca2+ sparks could provide information on the intracellular Ca2+&#160;handling properties of healthy and diseased striated muscles. Although Ca2+ sparks events are commonly seen in resting cardiomyocytes, they are rarely observed in resting skeletal muscle fibers; thus there is a need for methods to generate and analyze sparks in skeletal muscle fibers.
Detailed here is an experimental protocol for measuring Ca2+ sparks in isolated flexor digitorm brevis (FDB) muscle fibers using fluorescent Ca2+ indictors and laser scanning confocal microscopy. In this approach, isolated FDB fibers are exposed to transient hypoosmotic stress followed by a return to isotonic physiological solution. Under these conditions, a robust Ca2+ sparks response is detected adjacent to the sarcolemmal membrane in young healthy FDB muscle fibers. Altered Ca2+ sparks response is detected in dystrophic or aged skeletal muscle fibers. This approach has recently demonstrated that membrane-delimited signaling involving cross-talk between inositol (1,4,5)-triphosphate receptor (IP3R) and RyR contributes to Ca2+ spark activation in skeletal muscle. In summary, our studies using osmotic stress induced Ca2+ sparks showed that this intracellular response reflects a muscle signaling mechanism in physiology and aging/disease states, including mouse models of muscle dystrophy (mdx mice) or amyotrophic lateral sclerosis (ALS model).

Described here is a method to directly measure calcium sparks, the elementary units of Ca2+ release from sarcoplasmic reticulum&#160;in intact skeletal muscle fibers. This method utilizes osmotic-stress-mediated triggering of Ca2+ release from ryanodine receptor in isolated muscle fibers. The dynamics and homeostatic capacity of intracellular Ca2+ signaling can be employed to assess muscle function in health and disease.

تقييم الكالسيوم سباركس السليمة في ألياف العضلات الهيكلية

Maintaining homeostatic Ca2+ signaling is a fundamental physiological process in living cells. Ca2+ sparks are the elementary units of Ca2+ signaling in ...

Measuring the Osmotic Water Permeability Coefficient (Pf) of Spherical Cells: Isolated Plant Protoplasts as an Example

Studying AQP regulation mechanisms is crucial for the understanding of water relations at both the cellular and the whole plant levels. Presented here is a simple and very efficient method for the determination of the osmotic water permeability coefficient (Pf) in plant protoplasts, applicable in principle also to other spherical cells such as frog oocytes. The first step of the assay is the isolation of protoplasts from the plant tissue of interest by enzymatic digestion into a chamber with an appropriate isotonic solution. The second step consists of an osmotic challenge assay: protoplasts immobilized on the bottom of the chamber are submitted to a constant perfusion starting with an isotonic solution and followed by a hypotonic solution. The cell swelling is video recorded. In the third step, the images are processed offline to yield volume changes, and the time course of the volume changes is correlated with the time course of the change in osmolarity of the chamber perfusion medium, using a curve fitting procedure written in Matlab (the &#8216;PfFit&#8217;), to yield Pf.

Measuring the Osmotic Water Permeability Coefficient Pf of Spherical Cells: Isolated Plant Protoplasts as an Example

Measuring the osmotic water permeability coefficient (Pf) of cells can help understand the regulatory mechanisms of aquaporins (AQPs). Pf determination in spherical plant cell protoplasts presented here involves protoplasts isolation and numerical analysis of their initial rate of volume change as a result of an osmotic challenge during constant bath perfusion.

قياس معامل نفاذية المياه الأسموزي (P<sub&gt; و</sub&gt;) من خلايا كروية: Protoplasts محطة معزولة كمثال

Studying AQP regulation mechanisms is crucial for the understanding of water relations at both the cellular and the whole plant levels. Presented here is ...

Isolation of Murine Valve Endothelial Cells

Normal valve structures consist of stratified layers of specialized extracellular matrix (ECM) interspersed with valve interstitial cells (VICs) and surrounded by a monolayer of valve endothelial cells (VECs). VECs play essential roles in establishing the valve structures during embryonic development, and are important for maintaining life-long valve integrity and function. In contrast to a continuous endothelium over the surface of healthy valve leaflets, VEC disruption is commonly observed in malfunctioning valves and is associated with pathological processes that promote valve disease and dysfunction. Despite the clinical relevance, focused studies determining the contribution of VECs to development and disease processes are limited. The isolation of VECs from animal models would allow for cell-specific experimentation. VECs have been isolated from large animal adult models but due to their small population size, fragileness, and lack of specific markers, no reports of VEC isolations in embryos or adult small animal models have been reported. Here we describe a novel method that allows for the direct isolation of VECs from mice at embryonic and adult stages. Utilizing the Tie2-GFP reporter model that labels all endothelial cells with Green Fluorescent Protein (GFP), we have been successful in isolating GFP-positive (and negative) cells from the semilunar and atrioventricular valve regions using fluorescence activated cell sorting (FACS). Isolated GFP-positive VECs are enriched for endothelial markers, including CD31 and von Willebrand Factor (vWF), and retain endothelial cell expression when cultured; while, GFP-negative cells exhibit molecular profiles and cell shapes consistent with VIC phenotypes. The ability to isolate embryonic and adult murine VECs allows for previously unattainable molecular and functional studies to be carried out on a specific valve cell population, which will greatly improve our understanding of valve development and disease mechanisms.

The ability to isolate heart valve endothelial cells (VECs) is critical for understanding mechanisms of valve development, maintenance, and disease. Here we describe the isolation of VECs from embryonic and adult Tie2-GFP mice using FACS that will allow for studies determining the contribution of VECs in developmental and disease processes.

عزل خلايا الفئران صمام غشائي

Normal valve structures consist of stratified layers of specialized extracellular matrix (ECM) interspersed with valve interstitial cells (VICs) and ...

Quantitation of Endothelial Cell Adhesiveness In Vitro

One of the cardinal processes of inflammation is the infiltration of immune cells from the lumen of the blood vessel to the surrounding tissue. This occurs when endothelial cells, which line blood vessels, become adhesive to circulating immune cells such as monocytes. In vitro measurement of this adhesiveness has until now been done by quantifying the total number of monocytes that adhere to an endothelial layer either as a direct count or by indirect measurement of the fluorescence of adherent monocytes. While such measurements do indicate the average adhesiveness of the endothelial cell population, they are confounded by a number of factors, such as cell number, and do not reveal the proportion of endothelial cells that are actually adhesive. Here we describe and demonstrate a method which allows the enumeration of adhesive cells within a tested population of endothelial monolayer. Endothelial cells are grown on glass coverslips and following desired treatment are challenged with monocytes (that may be fluorescently labeled). After incubation, a rinsing procedure, involving multiple rounds of immersion and draining, the cells are fixed. Adhesive endothelial cells, which are surrounded by monocytes are readily identified and enumerated, giving an adhesion index that reveals the actual proportion of endothelial cells within the population that are adhesive.

Quantitation of Endothelial Cell Adhesiveness In Vitro

We report an in vitro method that allows the quantitation of the actual number of adhesive cells within an endothelial cell monolayer.

الكميات من البطانية الإلتصاق الخليوي<em&gt; في المختبر</em

One of the cardinal processes of inflammation is the infiltration of immune cells from the lumen of the blood vessel to the surrounding tissue. This ...

High-resolution Time-lapse Imaging and Automated Analysis of Microtubule Dynamics in Living Human Umbilical Vein Endothelial Cells

The physiological process by which new vasculature forms from existing vasculature requires specific signaling events that trigger morphological changes within individual endothelial cells (ECs). These processes are critical for homeostatic maintenance such as wound healing, and are also crucial in promoting tumor growth and metastasis. EC morphology is defined by the organization of the cytoskeleton, a tightly regulated system of actin and microtubule (MT) dynamics that is known to control EC branching, polarity and directional migration, essential components of angiogenesis. To study MT dynamics, we used high-resolution fluorescence microscopy coupled with computational image analysis of fluorescently-labeled MT plus-ends to investigate MT growth dynamics and the regulation of EC branching morphology and directional migration. Time-lapse imaging of living Human Umbilical Vein Endothelial Cells (HUVECs) was performed following transfection with fluorescently-labeled MT End Binding protein 3 (EB3) and Mitotic Centromere Associated Kinesin (MCAK)-specific cDNA constructs to evaluate effects on MT dynamics. PlusTipTracker software was used to track EB3-labeled MT plus ends in order to measure MT growth speeds and MT growth lifetimes in time-lapse images. This methodology allows for the study of MT dynamics and the identification of how localized regulation of MT dynamics within sub-cellular regions contributes to the angiogenic processes of EC branching and migration.

Protocols for Human Umbilical Vein Endothelial Cell (HUVEC) culture, transient transfection of fluorescently-labeled markers of microtubule growth, live-cell imaging and automated analysis of interphase microtubule growth dynamics are detailed.

عالية الدقة التصوير الوقت الفاصل بين وتحليل الآلي للأنيبيب حيوية في المعيشة السري الإنسان خلايا الوريد غشائي

The physiological process by which new vasculature forms from existing vasculature requires specific signaling events that trigger morphological changes ...

A Graphical User Interface for Software-assisted Tracking of Protein Concentration in Dynamic Cellular Protrusions

Filopodia are dynamic, finger-like cellular protrusions associated with migration and cell-cell communication. In order to better understand the complex signaling mechanisms underlying filopodial initiation, elongation and subsequent stabilization or retraction, it is crucial to determine the spatio-temporal protein activity in these dynamic structures. To analyze protein function in filopodia, we recently developed a semi-automated tracking algorithm that adapts to filopodial shape-changes, thus allowing parallel analysis of protrusion dynamics and relative protein concentration along the whole filopodial length. Here, we present a detailed step-by-step protocol for optimized cell handling, image acquisition and software analysis. We further provide instructions for the use of optional features during image analysis and data representation, as well as troubleshooting guidelines for all critical steps along the way. Finally, we also include a comparison of the described image analysis software with other programs available for filopodia quantification. Together, the presented protocol provides a framework for accurate analysis of protein dynamics in filopodial protrusions using image analysis software.

We present a software solution for semi-automated tracking of relative protein concentration along the length of dynamic cellular protrusions.

واجهة المستخدم الرسومية لتتبع بمساعدة برنامج تركيز البروتين في النتوءات الخلوية الديناميكية

Filopodia are dynamic, finger-like cellular protrusions associated with migration and cell-cell communication. In order to better understand the complex ...