El trabajo de investigación realizado en el laboratorio fue apoyado por becas de la Fundación de Investigación - Flandes (FWO, números de concesión G.0545.08 y G.0298.11), el Programa Interuniversitario Polos de atracción (Política Científica de Bélgica, el número de concesión P6/28 y P7/13) y está incrustado en una comunidad de investigación FWO apoyado. CDH es un becario posdoctoral de la Fundación de Investigación - Flandes (FWO). Los autores están muy agradecidos a todos los miembros actuales y anteriores del Laboratorio de Señalización Celular y Molecular (Universidad Católica de Lovaina), Dr. SP Srinivas (Escuela de Optometría de la Universidad de Indiana, EE.UU.), el laboratorio del Dr. Leybaert (Universidad de Gante) y de procedimientos Dr. Vinken (VUB), que proporcionó útil para los debates, optimizado o estuvieron involucrados en el desarrollo de herramientas para el estudio de hemichannels conexina.

1. Aislamiento de células endoteliales de la córnea Antes de empezar: Aislar las células de los ojos frescos, obtenidos de un matadero local, tan pronto como sea posible después de la enucleación del ojo. Asegúrese de que el ojo fue enucleado de una vaca de máximos de 18 meses, cinco minutos después de la autopsia y conservados en solución salina equilibrada de Earle - solución de yodo al 1% a 4 ° C para su transporte al laboratorio. <ol><li> Tome el ojo de solución salina equilibrada de la Earle - solución de yodo al 1% y lo coloca en una placa de Petri (100 x 20 mm). </li><li> Esterilizar el ojo con una solución que contiene etanol al 70% y enjuague con solución salina equilibrada de Earle que contiene 1% de yodo. </li><li> Partir de este paso, trabajar en una campana estéril. Diseccionar cuidadosamente la córnea del ojo y colocarlo en una placa de Petri (35 x 10 mm) que contiene solución salina equilibrada de Earle, con la capa de células epiteliales hacia arriba. Retire con cuidado el sti tejido del iris restantell unido a la córnea, si es necesario. </li><li> Transferencia de la córnea a la Solución salina equilibrada de otra Earle que contiene una placa de Petri con la capa de células endoteliales hacia arriba y enjuague dos veces con solución salina equilibrada de Earle. </li><li> Transferir la córnea con la capa endotelial hacia arriba a un reloj de arena, que es un plato en forma de copa, y se cubre con medio de crecimiento. El medio de cultivo consiste en Medio de Eagle Modificado de Dulbecco que contiene 25 mM de glucosa, 10% de suero fetal bovino, 6,6% de L-glutamina, 2,5 mg / ml de anfotericina-B y 1% de mezcla de antibiótico-antimicótico que contiene 10.000 unidades / ml de penicilina, 10 000 g / ml de estreptomicina, y 25 mg / ml de anfotericina B. </li><li> Retirar el medio con una pipeta de aspiración. </li><li> Aplicar 300 l de una solución de tripsina (0,5 g / L) a la capa endotelial de la córnea (todos los pasos que incluyen tripsina se realizan utilizando la misma concentración). </li><li> Coloque el reloj de arena que contiene la córnea en un plato de Petri cubierto y lo puso en el incubator durante 30 minutos a 37 ° C y 5% de CO 2. </li><li> Raspar suavemente las células endoteliales de distancia de la córnea con un pulido al fuego en forma de gancho pipeta Pasteur de vidrio en una campana estéril. </li><li> Aspirar la solución que contiene las células endoteliales y añadirlo a frascos de cultivo (25 cm 2), que contiene 4 ml de medio de cultivo. </li><li> Aplicar 300 l de medio de crecimiento a la córnea y repetir el raspado y añadir la solución que contiene las células endoteliales para el frasco de cultivo. </li><li> Repita este paso final (1,11) una vez más. </li><li> Coloque el matraces de cultivo que contiene las células endoteliales de la córnea en el medio de crecimiento en la incubadora a 37 ° C y 5% de CO 2. </li><li> Después de dos días, añadir 6 ml de medio de cultivo. </li><li> Actualizar el medio de cultivo cada dos días. </li></ol> 2. Cultivo Celular <ol><li> Retirar el medio de cultivo y se lavan las células dos veces con solución salina equilibrada de Earle, cuando confluencia se alcanza (dentro de About 10 días después del aislamiento). </li><li> Añadir 1,5 solución de tripsina ml a las células para separarlas y colocar el matraz en la incubadora (37 ° C, 5% de CO 2) durante 3 a 4 minutos. </li><li> Añadir 12 ml de medio de crecimiento. Pipetear los medios tres veces dentro y fuera de dispersar las células y contar las células. </li><li> Semillas de las células con una fracción variable dependiendo de la densidad de las células y los puso en la incubadora. Preparar dos diapositivas bien recámara (con un área de 4,2 cm 2) con un recuento de células de células 165 000 (densidad celular 39.286 por cm 2). Preparar 80 cm 2 frascos de cultivo de un nuevo paso a una densidad de 6.250 por cm 2, y añadir medio de cultivo nuevo hasta un volumen total de 25 ml. </li><li> Actualizar el medio cada dos días. </li><li> Confluencia de la capa de células que se alcanza después de 3 a 4 días. Usa las células para los experimentos. </li><li> Cuando confluencia de la capa de células en los matraces se alcanza, repita los pasos 2.1 a 2.6. Los cultivos de células hasta el paso 2 se puede utilizar fo experimentos. </li></ol> 3. La estimulación mecánica para inducir calcio Wave <ol><li> Cargue las células en el portaobjetos de cámara con 10 M Fluo-04 a.m. en buffer fosfato salino durante 30 minutos a 37 ° C mientras se agita suavemente. </li><li> Retire el Fluo-04 a.m. solución, lavar las células cinco veces con buffer fosfato salino, incubar las células con tampón fosfato salino y dejar las células durante al menos 5 minutos a temperatura ambiente antes de la medición. </li><li> Excite a 488 nm con láser de argón y el uso divisor de haz HFT 488, recoge la emisión de fluorescencia a 530 nm utilizando un paso largo filtro de emisión LP 505, establece el agujero en el mínimo. Utilice un objetivo de 40X aceite de inmersión (Air, 1,2 NA). En experimentos con ARL-67156, utilice un objetivo de 10X (Aire, 0,3 NA). </li><li> Búsqueda de un campo en el que las células son confluentes en el microscopio confocal. </li><li> Posición de la pipeta de manera que está en 45 ° con respecto a la corredera de cámara y tocar la membrana celular.Provocar una breve estimulación mecánica (≈ 1 seg) a una sola celda. La estimulación mecánica consiste en una deformación aguda, de corta duración de la célula tocando brevemente menos de 1% de la membrana celular con una micropipeta de vidrio (diámetro de la punta &lt;1 m) acoplado a un nanopositioner cristal piezoeléctrico, operado a través de un amplificador que es montado en un micromanipulador. Las micropipetas de vidrio están hechos de un extractor de microelectrodo. Asegúrese de que la nanopositioner es operado por una tensión de entre 0,2 y 1,5 V durante la estimulación mecánica. Una tensión superior a 1,5 V puede causar daño celular. Para cada tipo de célula y condiciones, la tensión óptima para la estimulación mecánica y sin daño de la célula debe ser determinada cuidadosamente mediante la aplicación de una serie de tensiones a partir de bajo (0,2 V) a alto voltaje (1,5 V). La tensión es una medida de la fuerza de la estimulación ya que esta tensión determina la tensión mecánica y la tensión que se aplica a la membrana celular. Lala fuerza de la estimulación mecánica se puede calcular multiplicando la tensión mecánica con la zona. Dado que tanto la zona (&lt;3,14 m 2) y el estrés mecánico son muy bajos, la fuerza de la estimulación mecánica es baja. (Tenga en cuenta que cuando una célula se daña, las fugas de fluorescencia fuera de la célula y la célula se vuelve oscuro.) </li><li> Medir los cambios espaciales de la [Ca2 +] i tras la estimulación mecánica con el microscopio confocal. </li><li> Recoger y almacenar imágenes. </li><li> Dibuje una región poligonal de interés para definir el área de la superficie total de las células de respuesta (área activa, AA) usando el software del microscopio confocal. </li></ol>

Los autores tienen nada que revelar.

En este manuscrito, se describe un método simple para medir intercelular Ca 2 + de propagación de la onda en monocapas de células endoteliales corneales bovinas primarias, proporcionando una estimulación mecánica localizada y controlada utilizando una micropipeta. Mecánicamente células estimuladas responden con un aumento local de IP intracelular 3 y Ca 2 +, ambos de los cuales son moléculas de señalización intracelulares esenciales que impulsan intercelular Ca 2 + en</sup...

La comunicación intercelular y la señalización son fundamentales para la coordinación de los procesos fisiológicos en respuesta a los agonistas extracelular en el tejido y 1,2 a nivel de todo el órgano. La forma más directa de comunicación intercelular es creada por la aparición de uniones. Gap cruces son las placas de los canales de salida brecha, que son canales proteicos formados por la cabeza a la cabeza de acoplamiento de dos (Cx) hemichannels conexina de células adyacentes 3,4 (Figura 1). Gap cruces permiten el paso de pequeñas moléculas de señalización con un peso molecular de menos de 1,5 kDa, incluyendo Ca 2 + o IP 3 5, causando y la modulación de Ca 2 +-liberación de los almacenes intracelulares de las células vecinas 6 (Figura 2). Canales de salida brecha están fuertemente regulados por intra e intermolecular interacciones de las proteínas y los procesos de señalización celular, como la modificación redox yfosforilación 7. Gjs facilitar la respuesta coordinada de células conectadas, actuando como un sincitio química y eléctrica. Por ejemplo, la propagación del potencial de acción cardíaco a través de los miocitos auriculares y ventriculares está mediada por canales GJ Cx basados ​​en 85. Cxs no sólo tienen un papel como canales de salida brecha, pero también forman hemichannels no apareados, de esta manera funcionarán como canales en las membranas de manera similar a los canales de iones regulares 8-10 (Figura 1). Hemichannels participan en la señalización paracrina entre las células vecinas mediante el control del intercambio de iones y moléculas de señalización entre el medio ambiente intra-y extracelular. En muchos tipos de células (como las células epiteliales, células osteoblásticas, astrocitos, células endoteliales, etc) y los órganos (como el cerebro, el hígado, la retina, cóclea y el sistema vascular), intercelular Ca 2 + olas son fundamentales para la coordinación de las respuestas multicelulares <sup&gt; 11. Los aumentos en intracelulares de Ca + niveles 2 en una determinada célula no se limitan a esta célula, pero se propagan a las células vecinas que rodean, estableciendo de ese modo un Ca intercelular 2 de la onda + 12,13. Estos intercelular Ca 2 +-ondas son importantes para la regulación fisiológica normal de las capas de células como un sincitio y su desregulación se ha asociado con los procesos fisiopatológicos 11. En el endotelio corneal y el epitelio, los diferentes grupos de 14-24, incluyendo la nuestra 25-33, estudiaron los mecanismos y las funciones de la comunicación intercelular. En células no excitables, como las células endoteliales de la córnea, dos modos distintos de la comunicación intercelular se producen 28,29, a saber brecha ocasiones la comunicación intercelular y la comunicación intercelular paracrina. Brecha ocasiones la comunicación intercelular implica un intercambio directo de moléculas de señalización a través de las uniones comunicantes 7. Gap juncla comunicación intercelular nal es crítico para mantener la homeostasis del tejido, el control de la proliferación celular, y el establecimiento de una respuesta sincronizada al estrés extracelular 10,34,35. En una serie de patologías, acoplamiento brecha de la salida se reduce debido a Cxs defectuosos, y por este medio que afecta brecha ocasiones la comunicación intercelular 36. Esto pone de relieve la importancia y la influencia de la brecha ocasiones la comunicación intercelular en los organismos multicelulares. En contraste con brecha ocasiones la comunicación intercelular, la comunicación intercelular paracrina no depende de la aposición de célula a célula, ya que implica la liberación de mensajeros extracelulares difusibles (Figura 2). Los diferentes tipos de moléculas de señalización se liberan en el espacio extracelular por señalización de células. La molécula se transporta a la célula diana donde se detecta por una proteína receptora específica. Posteriormente, el complejo receptor-señal induce una respuesta celular, que sese termina mediante la retirada de la señal, la inactivación o la desensibilización. Lipofílicas mensajeros de señalización extracelular Lanzamiento penetrar la membrana y actúan sobre los receptores intracelulares. En contraste, mensajeros hidrofílicos no atraviesan la membrana plasmática de la célula responder, sino que actúan como un ligando que se une a las proteínas del receptor expresado en la superficie, que luego se retransmiten la señal para el medio ambiente intracelular. Tres grandes familias de proteínas del receptor de la superficie celular que participen en este proceso: los canales iónicos-ligado, unido a enzima y la proteína G-vinculados. La molécula mensajera liberado puede actuar sobre los receptores de la misma célula (autocrina), sobre las células diana en estrecha proximidad (paracrina), o en las células diana distantes que requieren el sistema circulatorio (endocrina). En muchos tipos de células, incluyendo endotelio corneal 28,29, ATP es uno de los principales factores hidrófilos, paracrinos que impulsan la propagación de intercelular Ca 2 +-ondas 37-40. DurING deformación mecánica, la hipoxia, la inflamación o la estimulación por diversos agentes, el ATP puede ser liberado de las células sanas 41-44 en respuesta a la tensión de corte, estiramiento, o osmótica hinchazón 44,45. Diferentes mecanismos de ATP de liberación se han postulado, incluyendo exocitosis vesicular 44 y una plétora de mecanismos de transporte, tales como transportadores de unión a ATP de cassette (ABC), canales de aniones dependientes de voltaje plasmalemmal 46, P2X7 canales de los receptores de 47,48, así como conexina hemichannels 49-52 y pannexin hemichannels 43,49,53. ATP extracelular puede ser hidroliza rápidamente a ADP, AMP y adenosina 54,55 por ectonucleotidasas que están presentes en el medio ambiente extracelular. El ATP liberado extracelularmente y su metabolito ADP 56 se extenderán a través de la difusión. La posterior interacción de estos nucleótidos con los receptores purinérgicos en las células vecinas se ha implicado en la propagation de intercelular Ca 2 + olas 28,37,51. Dos clases diferentes de receptores purinérgicos están presentes: la adenosina es el principal ligando natural para P1-purinoceptores, mientras tanto purina (ATP, ADP) y la pirimidina (UTP, UDP) nucleótidos actúan en la mayoría de P2-purinoceptores 57. La comunicación intercelular puede ser investigado por diferentes métodos, tales como la carga de raspadura, la transferencia de tintes, uncaging local de los agonistas como IP 3 y Ca 2 +, la estimulación mecánica, etc. A continuación se describe el estudio de Ca 2 de propagación de la onda + provocada por la estimulación mecánica de una sola célula. La ventaja de estudiar Ca 2 de propagación de la onda + por estimulación mecánica es que proporciona una herramienta fácil de cuantificar la propagación de la Ca 2 de la onda + en el tiempo y que permite comparar cuantitativamente diferentes pretratamientos de las células. En el endotelio corneal, estos intercelular Ca 2 + olas permiten una corespuesta coordinada de la monocapa, por este medio que actúa como un posible mecanismo de defensa del endotelio corneal no regenerativa ayudar al endotelio para soportar tensiones extracelulares durante la cirugía intraocular, o tras la exposición a mediadores de la inflamación durante el rechazo inmunológico o uveítis 58,59.

<table border="1">
<tbody>
 <tr>
 <td>Name of Reagent/Material</td>
 <td>Company</td>
 <td>Catalog Number</td>
 <td>Column1</td>
 </tr>
 <tr>
 <td>Earle's Balanced Salt Solution (EBSS)</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>14155-048</td>
 <td></td>
 </tr>
 <tr>
 <td>Iodine</td>
 <td>Sigma-Aldrich (Deisenhofen, Germany)</td>
 <td>38060-1EA</td>
 <td></td>
 </tr>
 <tr>
 <td>Dulbecco's Modified Eagle's Medium (DMEM)</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>11960-044</td>
 <td></td>
 </tr>
 <tr>
 <td>L-glutamine (Glutamax)</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>35050-038</td>
 <td></td>
 </tr>
 <tr>
 <td>Amphotericin-B</td>
 <td>Sigma-Aldrich (Deisenhofen, Germany)</td>
 <td>A2942</td>
 <td></td>
 </tr>
 <tr>
 <td>Antibiotic-antimycotic mixture</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>15240-096</td>
 <td></td>
 </tr>
 <tr>
 <td>Trypsin</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>25300-054</td>
 <td></td>
 </tr>
 <tr>
 <td>Dulbecco's PBS</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>14190-091</td>
 <td></td>
 </tr>
 <tr>
 <td>Fluo-4 AM</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>F14217</td>
 <td></td>
 </tr>
 <tr>
 <td>ARL-67156 (6-N,N-Diethyl-b,g-dibromomethylene-D-ATP) </td>
 <td>Sigma-Aldrich (Deisenhofen, Germany)</td>
 <td>A265</td>
 <td></td>
 </tr>
 <tr>
 <td>Apyrase VI</td>
 <td>Sigma-Aldrich (Deisenhofen, Germany)</td>
 <td>A6410</td>
 <td></td>
 </tr>
 <tr>
 <td>Apyrase VII</td>
 <td>Sigma-Aldrich (Deisenhofen, Germany)</td>
 <td>A6535</td>
 <td></td>
 </tr>
 <tr>
 <td>Gap26 (VCYDKSFPISHVR)</td>
 <td>Custom peptide synthesis</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>Gap27 (SRPTEKTIFII)</td>
 <td>Custom peptide synthesis</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>Control Peptide (SRGGEKNVFIV)</td>
 <td>Custom peptide synthesis</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>siRNA1 Cx43 (sense: 5'GAAGGAGGAGGAACU-CAAAdTdT) </td>
 <td>Annealed siRNA was purchased at Eurogentec (Luik, Belgium)</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>siRNA2 Cx43 (sense: 5'CAAUUCUUCCUGCCGCAAUdTdT) </td>
 <td>Annealed siRNA was purchased at Eurogentec (Luik, Belgium)</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>siRNA scramble: scrambled sequence of siCx43-1 (sense: 5'GGUAAACG-GAACGAGAAGAdTdT) </td>
 <td>Annealed siRNA was purchased at Eurogentec (Luik, Belgium)</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>TAT-L2 (TAT- DGANVDMHLKQIEIKKFKYGIEEHGK)</td>
 <td>Thermo Electron (Ulm, Germany)</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>TAT-L2-H126K/I130N (TAT-DGANVDMKLKQNEIKKFKYGIEEHGK) </td>
 <td>Thermo Electron (Ulm, Germany)</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td></td>
 <td></td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>Two chambered glass slides</td>
 <td>Laboratory-Tek Nunc (Roskilde, Denmark)</td>
 <td>155380</td>
 <td></td>
 </tr>
 <tr>
 <td>Confocal microscope </td>
 <td>Carl Zeiss Meditec (Jena, Germany)</td>
 <td>LSM510</td>
 <td></td>
 </tr>
 <tr>
 <td>Piezoelectric crystal nanopositioner (Piezo Flexure NanoPositioner)</td>
 <td>PI Polytech (Karlsruhe, Germany)</td>
 <td>P-280</td>
 <td></td>
 </tr>
 <tr>
 <td>HVPZT-amplifier</td>
 <td>PI Polytech (Karlsruhe, Germany)</td>
 <td>E463 HVPZT-amplifier</td>
 <td></td>
 </tr>
 <tr>
 <td>Glass tubes (glass replacement 3.5 nanoliter)</td>
 <td>World Precision Instruments, Inc. Sarasota, Florida, USA</td>
 <td>4878</td>
 <td></td>
 </tr>
 <tr>
 <td>Microelectrode puller </td>
 <td>Zeitz Instrumente (Munchen, Germany)</td>
 <td>WZ DMZ-Universal Puller</td>
 <td></td>
 </tr>
</tbody>
 </table>

mechanical stimulation-induced calcium wave propagation in cell monolayers: the example of bovine corneal endothelial cells

La comunicación intercelular es esencial para la coordinación de procesos fisiológicos entre las células en una variedad de órganos y tejidos, incluyendo el cerebro, el hígado, la retina, cóclea y la vasculatura. En la configuración experimental, intercelular Ca 2 +-ondas puede ser obtenido mediante la aplicación de un estímulo mecánico a una sola celda. Esto conduce a la liberación de las moléculas intracelulares de señalización IP 3 y Ca 2 + que iniciar la propagación de la Ca 2 de la onda + concéntricamente desde la célula estimulada mecánicamente a las células vecinas. Las principales vías moleculares que controlan intercelular Ca 2 de propagación de la onda + son proporcionados por los canales de salida brecha a través de la transferencia directa de IP 3 y hemichannels a través de la liberación de ATP. Identificación y caracterización de las propiedades y la regulación de diferentes conexina y isoformas pannexin como canales y hemichannels brecha de la salida son permitidas por el quantification de la propagación de la intercelular Ca 2 de la onda +, ARNsi, y el uso de inhibidores de canales y hemichannels brecha de la salida. Aquí, se describe un método para medir intercelular Ca 2 de la onda + en monocapas de células endoteliales corneales primarias cargado con Fluo4-AM en respuesta a un estímulo mecánico controlado y localizado provocado por una deformación aguda, de corta duración de la célula como resultado de tocar la membrana celular con una micropipeta de vidrio micromanipulador-controlado con un diámetro de la punta de menos de 1 m. También describe el aislamiento de células endoteliales corneales bovinas primarias y su uso como sistema modelo para evaluar la actividad Cx43-hemicanal como la fuerza impulsada por intercelular Ca 2 +-ondas a través de la liberación de ATP. Finalmente, se discute el uso, ventajas, limitaciones y alternativas de este método en el contexto del canal brecha de la salida y la investigación hemicanal.

Todos los experimentos se realizan en cumplimiento de todas las directrices, reglamentos y las agencias reguladoras y el protocolo que se está demostrado se lleva a cabo bajo la dirección y aprobación del cuidado de los animales y el empleo de la Universidad Católica de Lovaina. En las células endoteliales corneales bovinas (BCEC), uniones funcionales se expresan y ambos brecha ocasiones la comunicación intercelular y la comunicación intercelular paracrina contribuyen de manera signif...

Watch this Scientific Journal Video about Mechanical Stimulation-induced Calcium Wave Propagation in Cell Monolayers: The Example of Bovine Corneal Endothelial Cells at JoVE.com

Mechanical Stimulation-induced Calcium Wave Propagation in Cell Monolayers: The Example of Bovine Corneal Endothelial Cells

Intercelular Ca<sup&gt; 2 +</sup&gt; Las ondas son conducidas por canales y hemichannels brecha de la salida. Aquí se describe un método para medir intercelular Ca<sup&gt; 2 +</sup&gt;-Ondas en monocapas de células en respuesta a un estímulo mecánico de una sola célula local y su aplicación para investigar las propiedades y la regulación de los canales y hemichannels brecha de la salida.

Mecánica estimulación inducida por calcio Propagación de Ondas en monocapas de células: el ejemplo de las especies bovina células endoteliales corneales

Intercellular communication is essential for the coordination of physiological processes between cells in a variety of organs and tissues, including the ...

mechanical-stimulation-induced-calcium-wave-propagation-cell

Research

JoVE Journal

Biology

16.2K vistas.  KU Leuven. Intercelular Ca 2 + Las ondas son conducidas por canales y hemichannels brecha de la salida. Aquí se describe un método para medir intercelular Ca 2 +-Ondas en monocapas de células en respuesta a un estímulo mecánico de una sola célula local y su aplicación para investigar las propiedades y la regulación de los canales y hemichannels brecha de la salida.

Video: Mechanical Stimulation-induced Calcium Wave Propagation in Cell Monolayers: The Example of Bovine Corneal Endothelial Cells

Propagation of Human Embryonic Stem (ES) Cells

Propagation of Human Embryonic Stem ES Cells

Yeah, so I'm Lauren Deon. I'm in charge of the Human Amgen stem cell co facility at MGH. Yeah, so I'm Lauren, I'm in charge of the Human AM stem cell co facility at MGH.So I've been working with human Amgen stem cells for years now since I was a postdoc in George De Lab before, from four, four years. And so right now we have two cell lines, H one and H nine, which are both from Y cell. And so the way we are expanding or maintaining these cells in culture is by, at least the way we are splitting these cells is by using collagenous.So what I usually do is for the first few passage after throwing the cells, I use a technical, the picking colonies. So in this case, I can check under the microscope which colonies are good and differentiate and nice shape, and I will collect only these colonies and I will cut them in few pieces and put them back in, in a fresh flat. And the, the colonies that look kind of differentiate it are just left them alone.The other way to pass the cells is by using trypsin. So I don't use this technique here. I think collagenase is a little bit safer because human being stem cells don't like to be individualized or they don't like to be alone.So if you do trypsin, if you use trypsin for a little bit too long, if you use it for like three to four minutes, which is the way we use strips in for other type of cells, human stem cells will be individualized and most of them will die or just differentiate or will not attach to the myth. So the idea is you have to keep the cells as clumps. You don't want them to be alone in the in, in the flask.So using collagenase, the advantage is to keep cells as plants. Using chipsy, you just select for cells that will survive this very, very harsh process of g opsonization. So these cells are usually very highly proliferative.So you get, you can adapt your cells to this tripsin process. The problem is that you have cells that they behave differently, they go much faster. And one risk is that you can get some commercial abnormality to, to this, to this very high division process.So you say that ization can cause selection of cells in culture for most proliferative cells.Right. More ative and probably also higher survival rates than other cells. So after proliferation, basically culture after proliferation in tripsin, after several passages become a different culture, these different properties.So it's, it's hard to figure out if they are exactly identical. If you do the test, the usual test, let's say you check markers, regular markers of end differentiated cells like OC four, nano one 60 SC four C, C3, all this molecule might still be expressed. If you do TER formation, this cells might still differentiate and be formed like al like normal cells.If you look at the karyotype, you might have some abnormality, but you might still have a normal karyotype. The, the, the selective advantage might be due to just a mutation that you cannot see by doing a karyotype. So the fact that they grow much faster is by itself I think a little bit worser.And if we want to use these cells for transplantation at some point, I would definitely not use this type of cells.Okay. So would you like to tell me what are the main technical problems with using this technique for, for passages of cells? So using S, yes.It's just a little bit longer and also it's, since the cells are not going as fast, it's just much longer to get a high number of cells to do some experiment. So it's just less convenient I would say. Would you like to tell me about few words about the goals of your experiment?How do you use CS cells? Okay, so my main project here is to get endothelial cells from human AB stem cells. And the idea is to be able to make blood.And we are working a lot with tissue bioengineering labs and one of their goal is to make tissue in vitro. But one of the limitation to this is the lack of blood vessels going through this tissues. So if we can bring endothelial cells or put endothelial cells in this tissue, we would have better growth of this tissue.So the idea few sources of cells are known for endothelial cells like cold blood or pressure blood, but it would be interesting to have another source of cells like human years. And the advantage is since human years can be expanded and most infinitely, you could modify these cells, make some inducible system and be able to use it. Then in your final product, your material cells, in this case.

Propagación de la madre embrionarias humanas (ES) Células

Investigación

Biología

Isolation and Large Scale Expansion of Adult Human Endothelial Colony Forming Progenitor Cells

This paper introduces a novel recovery strategy for endothelial colony forming progenitor cells (ECFCs) from heparinized but otherwise unmanipulated adult human peripheral blood within a mean of 12 days. After large scale expansion &gt;1x108 ECFCs can be obtained for further tests. Advantageously by using pHPL the contact of human cells with bovine serum antigens can be excluded. By flow cytometry and immunohistochemistry the isolated cells can be characterized as ECFC and their in vitro functionality to form vascular like structures can be tested in a matrigel assay. Further these cells can be subcutaneously injected in a mouse model to form functional, perfused vessels in vivo. After long term expansion and cryopreservation proliferation, function and genomic stability appear to be preserved. 3,4
This animal-protein free isolation and expansion method is easily applicable to generate a large quantity of ECFCs.

Endothelial colony forming progenitor cells (ECFCs) are a promising tool to study vascular homeostasis and repair.1,2 This paper introduces a novel animal-serum free method for isolation and expansion of ECFC from heparinised adult human peripheral blood with pooled human platelet lysate (pHPL) diminishing the risk of anti-bovine immunisation.

El aislamiento y la expansión a gran escala de células humanas adultas Colonia progenitoras endoteliales formación

This paper introduces a novel recovery strategy for endothelial colony forming progenitor cells (ECFCs) from heparinized but otherwise unmanipulated adult ...

Study of the Actin Cytoskeleton in Live Endothelial Cells Expressing GFP-Actin

The microvascular endothelium plays an important role as a selectively permeable barrier to fluids and solutes. The adhesive junctions between endothelial cells regulate permeability of the endothelium, and many studies have indicated the important contribution of the actin cytoskeleton to determining junctional integrity1-5. A cortical actin belt is thought to be important for the maintenance of stable junctions1, 2, 4, 5. In contrast, actin stress fibers are thought to generate centripetal tension within endothelial cells that weakens junctions2-5. Much of this theory has been based on studies in which endothelial cells are treated with inflammatory mediators known to increase endothelial permeability, and then fixing the cells and labeling F-actin for microscopic observation. However, these studies provide a very limited understanding of the role of the actin cytoskeleton because images of fixed cells provide only snapshots in time with no information about the dynamics of actin structures5. 
Live-cell imaging allows incorporation of the dynamic nature of the actin cytoskeleton into the studies of the mechanisms determining endothelial barrier integrity. A major advantage of this method is that the impact of various inflammatory stimuli on actin structures in endothelial cells can be assessed in the same set of living cells before and after treatment, removing potential bias that may occur when observing fixed specimens. Human umbilical vein endothelial cells (HUVEC) are transfected with a GFP-&beta;-actin plasmid and grown to confluence on glass coverslips. Time-lapse images of GFP-actin in confluent HUVEC are captured before and after the addition of inflammatory mediators that elicit time-dependent changes in endothelial barrier integrity. These studies enable visual observation of the fluid sequence of changes in the actin cytoskeleton that contribute to endothelial barrier disruption and restoration. 
Our results consistently show local, actin-rich lamellipodia formation and turnover in endothelial cells. The formation and movement of actin stress fibers can also be observed. An analysis of the frequency of formation and turnover of the local lamellipodia, before and after treatment with inflammatory stimuli can be documented by kymograph analyses. These studies provide important information on the dynamic nature of the actin cytoskeleton in endothelial cells that can used to discover previously unidentified molecular mechanisms important for the maintenance of endothelial barrier integrity.

Microscopic imaging of live endothelial cells expressing GFP-actin allows characterization of dynamic changes in cytoskeletal structures. Unlike techniques that use fixed specimens, this method provides a detailed assessment of temporal changes in the actin cytoskeleton in the same cells before, during, and after various physical, pharmacological, or inflammatory stimuli.

Estudio del citoesqueleto de actina en vivo las células endoteliales que expresan GFP-actina

The microvascular endothelium plays an important role as a selectively permeable barrier to fluids and solutes. The adhesive junctions between endothelial ...

Assessment of Calcium Sparks in Intact Skeletal Muscle Fibers

Maintaining homeostatic Ca2+ signaling is a fundamental physiological process in living cells. Ca2+ sparks are the elementary units of Ca2+ signaling in the striated muscle fibers that appear as highly localized Ca2+ release events mediated by ryanodine receptor (RyR) Ca2+ release channels on the sarcoplasmic reticulum (SR) membrane. Proper assessment of muscle Ca2+ sparks could provide information on the intracellular Ca2+&#160;handling properties of healthy and diseased striated muscles. Although Ca2+ sparks events are commonly seen in resting cardiomyocytes, they are rarely observed in resting skeletal muscle fibers; thus there is a need for methods to generate and analyze sparks in skeletal muscle fibers.
Detailed here is an experimental protocol for measuring Ca2+ sparks in isolated flexor digitorm brevis (FDB) muscle fibers using fluorescent Ca2+ indictors and laser scanning confocal microscopy. In this approach, isolated FDB fibers are exposed to transient hypoosmotic stress followed by a return to isotonic physiological solution. Under these conditions, a robust Ca2+ sparks response is detected adjacent to the sarcolemmal membrane in young healthy FDB muscle fibers. Altered Ca2+ sparks response is detected in dystrophic or aged skeletal muscle fibers. This approach has recently demonstrated that membrane-delimited signaling involving cross-talk between inositol (1,4,5)-triphosphate receptor (IP3R) and RyR contributes to Ca2+ spark activation in skeletal muscle. In summary, our studies using osmotic stress induced Ca2+ sparks showed that this intracellular response reflects a muscle signaling mechanism in physiology and aging/disease states, including mouse models of muscle dystrophy (mdx mice) or amyotrophic lateral sclerosis (ALS model).

Described here is a method to directly measure calcium sparks, the elementary units of Ca2+ release from sarcoplasmic reticulum&#160;in intact skeletal muscle fibers. This method utilizes osmotic-stress-mediated triggering of Ca2+ release from ryanodine receptor in isolated muscle fibers. The dynamics and homeostatic capacity of intracellular Ca2+ signaling can be employed to assess muscle function in health and disease.

Evaluación de calcio en Sparks intactas las fibras musculares esqueléticas

Maintaining homeostatic Ca2+ signaling is a fundamental physiological process in living cells. Ca2+ sparks are the elementary units of Ca2+ signaling in ...

Analysis of Oxidative Stress in Zebrafish Embryos

High levels of reactive oxygen species (ROS) may cause a change of cellular redox state towards oxidative stress condition. This situation causes oxidation of molecules (lipid, DNA, protein) and leads to cell death. Oxidative stress also impacts the progression of several pathological conditions such as diabetes, retinopathies, neurodegeneration, and cancer. Thus, it is important to define tools to investigate oxidative stress conditions not only at the level of single cells but also in the context of whole organisms. Here, we consider the zebrafish embryo as a useful in vivo system to perform such studies and present a protocol to measure in vivo oxidative stress. Taking advantage of fluorescent ROS probes and zebrafish transgenic fluorescent lines, we develop two different methods to measure oxidative stress in vivo: i) a &#8220;whole embryo ROS-detection method&#8221; for qualitative measurement of oxidative stress and ii) a &#8220;single-cell&#160;ROS detection method&#8221; for quantitative measurements of oxidative stress. Herein, we demonstrate the efficacy of these procedures by increasing oxidative stress in tissues by oxidant agents and physiological or genetic methods. This protocol is amenable for forward genetic screens and it will help address cause-effect relationships of ROS in animal models of oxidative stress-related pathologies such as neurological disorders and cancer.

Here we report a protocol to measure oxidative stress in living zebrafish embryos. This procedure allows reactive oxygen species (ROS) detection in both whole embryo tissues and single-cell populations. This protocol will accomplish both qualitative and quantitative analyses.

Análisis de estrés oxidativo en embriones de pez cebra

High levels of reactive oxygen species (ROS) may cause a change of cellular redox state towards oxidative stress condition. This situation causes ...

Measuring the Osmotic Water Permeability Coefficient (Pf) of Spherical Cells: Isolated Plant Protoplasts as an Example

Studying AQP regulation mechanisms is crucial for the understanding of water relations at both the cellular and the whole plant levels. Presented here is a simple and very efficient method for the determination of the osmotic water permeability coefficient (Pf) in plant protoplasts, applicable in principle also to other spherical cells such as frog oocytes. The first step of the assay is the isolation of protoplasts from the plant tissue of interest by enzymatic digestion into a chamber with an appropriate isotonic solution. The second step consists of an osmotic challenge assay: protoplasts immobilized on the bottom of the chamber are submitted to a constant perfusion starting with an isotonic solution and followed by a hypotonic solution. The cell swelling is video recorded. In the third step, the images are processed offline to yield volume changes, and the time course of the volume changes is correlated with the time course of the change in osmolarity of the chamber perfusion medium, using a curve fitting procedure written in Matlab (the &#8216;PfFit&#8217;), to yield Pf.

Measuring the Osmotic Water Permeability Coefficient Pf of Spherical Cells: Isolated Plant Protoplasts as an Example

Measuring the osmotic water permeability coefficient (Pf) of cells can help understand the regulatory mechanisms of aquaporins (AQPs). Pf determination in spherical plant cell protoplasts presented here involves protoplasts isolation and numerical analysis of their initial rate of volume change as a result of an osmotic challenge during constant bath perfusion.

Medición de la osmótica de agua Coeficiente de Permeabilidad (P<sub&gt; F</sub&gt;) De células esféricas: protoplastos de plantas aisladas como ejemplo

Studying AQP regulation mechanisms is crucial for the understanding of water relations at both the cellular and the whole plant levels. Presented here is ...

Isolation of Murine Valve Endothelial Cells

Normal valve structures consist of stratified layers of specialized extracellular matrix (ECM) interspersed with valve interstitial cells (VICs) and surrounded by a monolayer of valve endothelial cells (VECs). VECs play essential roles in establishing the valve structures during embryonic development, and are important for maintaining life-long valve integrity and function. In contrast to a continuous endothelium over the surface of healthy valve leaflets, VEC disruption is commonly observed in malfunctioning valves and is associated with pathological processes that promote valve disease and dysfunction. Despite the clinical relevance, focused studies determining the contribution of VECs to development and disease processes are limited. The isolation of VECs from animal models would allow for cell-specific experimentation. VECs have been isolated from large animal adult models but due to their small population size, fragileness, and lack of specific markers, no reports of VEC isolations in embryos or adult small animal models have been reported. Here we describe a novel method that allows for the direct isolation of VECs from mice at embryonic and adult stages. Utilizing the Tie2-GFP reporter model that labels all endothelial cells with Green Fluorescent Protein (GFP), we have been successful in isolating GFP-positive (and negative) cells from the semilunar and atrioventricular valve regions using fluorescence activated cell sorting (FACS). Isolated GFP-positive VECs are enriched for endothelial markers, including CD31 and von Willebrand Factor (vWF), and retain endothelial cell expression when cultured; while, GFP-negative cells exhibit molecular profiles and cell shapes consistent with VIC phenotypes. The ability to isolate embryonic and adult murine VECs allows for previously unattainable molecular and functional studies to be carried out on a specific valve cell population, which will greatly improve our understanding of valve development and disease mechanisms.

The ability to isolate heart valve endothelial cells (VECs) is critical for understanding mechanisms of valve development, maintenance, and disease. Here we describe the isolation of VECs from embryonic and adult Tie2-GFP mice using FACS that will allow for studies determining the contribution of VECs in developmental and disease processes.

Aislamiento de las células murinas de la válvula endoteliales

Normal valve structures consist of stratified layers of specialized extracellular matrix (ECM) interspersed with valve interstitial cells (VICs) and ...

Quantitation of Endothelial Cell Adhesiveness In Vitro

One of the cardinal processes of inflammation is the infiltration of immune cells from the lumen of the blood vessel to the surrounding tissue. This occurs when endothelial cells, which line blood vessels, become adhesive to circulating immune cells such as monocytes. In vitro measurement of this adhesiveness has until now been done by quantifying the total number of monocytes that adhere to an endothelial layer either as a direct count or by indirect measurement of the fluorescence of adherent monocytes. While such measurements do indicate the average adhesiveness of the endothelial cell population, they are confounded by a number of factors, such as cell number, and do not reveal the proportion of endothelial cells that are actually adhesive. Here we describe and demonstrate a method which allows the enumeration of adhesive cells within a tested population of endothelial monolayer. Endothelial cells are grown on glass coverslips and following desired treatment are challenged with monocytes (that may be fluorescently labeled). After incubation, a rinsing procedure, involving multiple rounds of immersion and draining, the cells are fixed. Adhesive endothelial cells, which are surrounded by monocytes are readily identified and enumerated, giving an adhesion index that reveals the actual proportion of endothelial cells within the population that are adhesive.

Quantitation of Endothelial Cell Adhesiveness In Vitro

We report an in vitro method that allows the quantitation of the actual number of adhesive cells within an endothelial cell monolayer.

La cuantificación de la adhesividad de la célula endotelial<em&gt; In Vitro</em

One of the cardinal processes of inflammation is the infiltration of immune cells from the lumen of the blood vessel to the surrounding tissue. This ...

High-resolution Time-lapse Imaging and Automated Analysis of Microtubule Dynamics in Living Human Umbilical Vein Endothelial Cells

The physiological process by which new vasculature forms from existing vasculature requires specific signaling events that trigger morphological changes within individual endothelial cells (ECs). These processes are critical for homeostatic maintenance such as wound healing, and are also crucial in promoting tumor growth and metastasis. EC morphology is defined by the organization of the cytoskeleton, a tightly regulated system of actin and microtubule (MT) dynamics that is known to control EC branching, polarity and directional migration, essential components of angiogenesis. To study MT dynamics, we used high-resolution fluorescence microscopy coupled with computational image analysis of fluorescently-labeled MT plus-ends to investigate MT growth dynamics and the regulation of EC branching morphology and directional migration. Time-lapse imaging of living Human Umbilical Vein Endothelial Cells (HUVECs) was performed following transfection with fluorescently-labeled MT End Binding protein 3 (EB3) and Mitotic Centromere Associated Kinesin (MCAK)-specific cDNA constructs to evaluate effects on MT dynamics. PlusTipTracker software was used to track EB3-labeled MT plus ends in order to measure MT growth speeds and MT growth lifetimes in time-lapse images. This methodology allows for the study of MT dynamics and the identification of how localized regulation of MT dynamics within sub-cellular regions contributes to the angiogenic processes of EC branching and migration.

Protocols for Human Umbilical Vein Endothelial Cell (HUVEC) culture, transient transfection of fluorescently-labeled markers of microtubule growth, live-cell imaging and automated analysis of interphase microtubule growth dynamics are detailed.

-Alta resolución de imagen de lapso de tiempo y análisis automatizado de los microtúbulos en la dinámica de estar umbilical humana Las células endoteliales de vena

The physiological process by which new vasculature forms from existing vasculature requires specific signaling events that trigger morphological changes ...

A Graphical User Interface for Software-assisted Tracking of Protein Concentration in Dynamic Cellular Protrusions

Filopodia are dynamic, finger-like cellular protrusions associated with migration and cell-cell communication. In order to better understand the complex signaling mechanisms underlying filopodial initiation, elongation and subsequent stabilization or retraction, it is crucial to determine the spatio-temporal protein activity in these dynamic structures. To analyze protein function in filopodia, we recently developed a semi-automated tracking algorithm that adapts to filopodial shape-changes, thus allowing parallel analysis of protrusion dynamics and relative protein concentration along the whole filopodial length. Here, we present a detailed step-by-step protocol for optimized cell handling, image acquisition and software analysis. We further provide instructions for the use of optional features during image analysis and data representation, as well as troubleshooting guidelines for all critical steps along the way. Finally, we also include a comparison of the described image analysis software with other programs available for filopodia quantification. Together, the presented protocol provides a framework for accurate analysis of protein dynamics in filopodial protrusions using image analysis software.

We present a software solution for semi-automated tracking of relative protein concentration along the length of dynamic cellular protrusions.

Una interfaz gráfica de usuario para el seguimiento asistido por software de la concentración de proteínas en protones dinámicos celulares

Filopodia are dynamic, finger-like cellular protrusions associated with migration and cell-cell communication. In order to better understand the complex ...