עבודה זו נתמכת על ידי האגודה לקידום חדשנות לנוער CAS (2021084) וקרן התמיכה בפרויקט פריסת המפתח של תוכנית הפעולה התלת-שנתית של המכון למיקרוביולוגיה, האקדמיה הסינית למדעים.

1. הכנת צמחי N. benthamiana
<ol><li>מניחים את קוביות השתיל במגש, מוסיפים ליטר מים ומשרים כשעתיים עד לרוויה מלאה.</li>
	<li>מפזרים באופן שווה זרעי בר מסוג N. benthamiana על אבני השתיל, מכסים במכסה ונובטים במשך שבוע אחד. לגדל N. benthamiana בחממה עם 18 שעות photoperiod, 24 ° C, 45% לחות יחסית, ולהפרות כל שבועיים.</li>
	<li>לאחר שהזרעים נבטו, השתמשו בפינצטה כדי להסיר שתיל בעדינות, תוך הקפדה שלא לגרום נזק לשורשיו. חופרים בור קטן במרכזו של מגש חדש, מניחים בו את השתיל ומכסים קלות את השורשים באדמה. מכסים במכסה וממשיכים לגדול.</li>
	<li>לגדול עד שתילים יש שלושה עלים, עם המכסה על. יש להסיר את המכסה כאשר העלההאמיתי ה-4 מגיח.</li>
	<li>לאפשר לצמחים להמשיך לגדול במשך שבועיים נוספים לפני חלחול חקלאי.</li>
</ol>2. בניית GFP רקומביננטי-שלו
<ol><li>לבצע אופטימיזציה של N . benthamiana codon וסינתזה של GFP ו- PR1a (MGFVLFSQLPSFLLVSTLLLFLVISHSCRAG) בהתבסס על רצפי הגנים.</li>
	<li>בצע עיכול כפול של וקטור pCAMBIA1300 באמצעות אנזימים Xba I ו- Sac I (ראה טבלת חומרים).</li>
	<li>ביצוע הגברה של PR1a באמצעות פריימרים במעלה הזרם (TTGGAGAGAACGGGGGACTCTAGAATGGGATT TGTTCTCTTTTC) ופריימרים במורד הזרם (TCCTCG CCCTTGCTCACCATGTCGACCCCGGCACGGCAAGA GTGGG), הגברה של GFP באמצעות פריימרים במעלה הזרם (CCCACTCTTGCCGTGCCGGGGTCGACATGGTGAG CAAGGGCGAGGA) ופריימרים במורד הזרם (GGGGAAATTCGAGCTCAGTGGTGATGGTGGTGGTG GTGAGATCTTCCGGACTTGT).</li>
	<li>שימוש ברקומבינציה הומולוגית, שיבוט PR1a ו-GFP לווקטור ביטוי הצמחים pCAMBIA1300. לאחר המעבר ל - E. coli, בחר שיבוטים בודדים ושלח אותם לחברה לריצוף. השוואה בין תוצאות הריצוף לבין הפלסמיד הימני הוא פלסמיד רקומביננטי pCAMBIA1300-PR1a-GFP-His, המכונה p35s-PR1a-GFP-His.</li>
</ol>3. ייצור GFP-שלו ב N. benthamiana
<ol><li>הוסף 1 μL של פלסמיד GFP לתוך 50 μL של תאים קולטן Agrobacterium GV3101, לערבב בעדינות ולהוסיף לכוס אלקטרודה, להסיר לאחר electrocution על electroshocker.</li>
	<li>התפשטות Agrobacterium tumefaciens מותמרת על צלחת בינונית מוצקה LB המכילה 50 מיקרוגרם/מ"ל קנמיצין (Kan) ו-50 מיקרוגרם/מ"ל ריפמפיצין (Rif). דגירה הפוכה ב 28 ° C במשך 48 שעות. וקטור pCAMBIA1300 עמיד בפני קאן, ואגרובקטריום עמיד בפני ריף; רק אגרובקטריום נכון יכול לגדול על צלחות עם קאן וריף. השיבוטים החד-שבטיים היו הטרנספורמנטים החיוביים, שנקראו A. tumefaciens GV3101-p35s-PR1a-GFP-His (AtGPG).</li>
	<li>השתמש קיסם מעוקר כדי להרים כמות מתאימה של AtGPG ולחסן אותו לתוך 4 מ"ל של LB נוזלי עם Kan ו Rif. תרבות ב 28 ° C, 220-300 סל"ד במשך 24 שעות.</li>
	<li>תת-תרבית חיידקים 1:50 לתוך LB טרי (50 מיקרוגרם / מ"ל Kan, 10 mM 2-(N-Morpholino) חומצה ethanesulfonic (MES), 20 מיקרומטר אצטוסירינגון (AS)) ולדגור ב 28 ° C, 220-300 סל"ד במשך 10-12 שעות.</li>
	<li>קצור חיידקים על ידי צנטריפוגה ב 1500 x גרם במשך 10 דקות והשהה מחדש את הגלולה עם 1 מ"ל MMA (10 mM MgCl2, 10 mM MES pH 5.6, 100 μM AS).</li>
	<li>מדוד וכוונן את הצפיפות האופטית (OD) של AtGPG ל- OD600=0.8 באמצעות MMA. דוגרים על החיידקים עוד 2-4 שעות בטמפרטורת החדר. ציירו את התמיסה החיידקית עם מזרק ללא מחט, לחצו אותו קלות על גב העלים, ותנו לחץ לחדור את התמיסה לעלים. מזריקים רק את 3-4 העלים האמצעיים לכל צמח.</li>
	<li>ממשיכים לגדל N. benthamiana בחממה במשך 3-4 ימים לפני קציר עלים למיצוי חלבון.</li>
</ol>4. התבוננות בלוקליזציה תת-תאית של GFP
<ol><li>לאחר 48 שעות של חדירה חקלאית, בחר עלה שטוח והשתמש בניקוב חור 6 מ"מ כדי להדק את הלהב לניקוב.</li>
	<li>טפטפו תמיסת 30% סוכרוז על מגלשת זכוכית, הניחו את דוגמת העלה כשהגב פונה כלפי מעלה וכסו אותה בכוס כיסוי.</li>
	<li>הגדר את אורך גל העירור ל 488 ננומטר וזהה את הפלואורסצנטיות הירוקה ב 490-550 ננומטר לאחר הגדלה של 400x. צלם את התמונה הראשונה לאחר הכנת השקופית ותמונה נוספת 10 דקות לאחר מכן.</li>
</ol>5. מיצוי GFP מהצמח
<ol><li>מיצוי AWF<ol><li>יש לאסוף את עלי N. benthamiana הטריים השלמים המבטאים GFP רקומביננטי לאחר 3 ימים לאחר ההסתננות. יש לטפל בעלה בעדינות ולשמור על שלמות העלה כדי למנוע פליטת חלבון תוך-תאית. השתמשו בעלים שנאספו לשלב הבא באופן מיידי כדי למנוע פירוק חלבון.</li>
		<li>יש לשטוף את להב העלה ב-ddH2O מעוקר מראש כדי להסיר לכלוך.</li>
		<li>שוקלים עלים טריים וטובלים 20 גרם עלים (הצד האבקסי כלפי מטה) ב-100 מ"ל של חיץ פוספט מקורר מראש של 100 מילימטר (PB 100 mM Na2HPO4 ו-100 mM NaH2PO4 הוגדרו בנפרד ועורבבו ביחס של 2.2:1 pH 7.0) בכד רחב פה של 200 מ"ל. מכסים את העלים בחוט רשת דק מניילון 100 רשת (ראו טבלת חומרים) ובצלחת פלסטיק. הערה: קירור מקדים מונע פירוק חלבונים. ניתן לכוונן נפחי מאגר בהתבסס על קנה המידה הניסיוני. ודא שכל העלים שקועים.</li>
		<li>הכניסו את הכד למשאבת ואקום. החל שואב אבק 0.8 MPa למשך דקה אחת, ולאחר מכן שחזר במהירות ללחץ אטמוספרי.</li>
		<li>מוציאים את העלים מהמאגר ומייבשים בעדינות עם נייר סופג. לגלגל עלים, לעטוף עם חוט רשת, ומניחים 5 גרם של עלים לתוך כל צינור צנטריפוגה 50 מ"ל. כדי לאסוף AWF, מקם עלים מגולגלים בקצה הצד בצינורות עם חוט רשת המהודק על ידי מכסי הצינורות.</li>
		<li>צנטריפוגה ב-4°C, 500 x גרם למשך 5 דקות. מוציאים עלים ואוספים את ה-AWF בתחתית הצינור באמצעות פיפטה. ניתן לקבל כ -5 מ"ל של AWF מכל צינור. הערה: על מנת למזער הפרעות מחלבונים תוך-תאיים ולמצות את הכמות המרבית של חלבוני AWF, ניתן לחזור על המיצוי 2x-3x, אך לא יותר מ-3x.</li>
	</ol></li>
	<li>מיצוי חלבון מסיס כולל<ol><li>טוחנים 20 גר' עלים לאבקה דקה בחנקן נוזלי. הוסף מאגר מיצוי (50 mM Tris-HCl pH 7.4, 150 mM NaCl, 10% גליצרול, 1% Triton X-100, 0.034% β-מרקפטואתנול (ראה טבלת חומרים)) ביחס של 1:2.</li>
		<li>נערו הומוגנט במיקסר אנכי במשך 30 דקות ב-4°C. צנטריפוגה הומוגנית ב 13,000 x גרם במשך 15 דקות ב 4 ° C.</li>
		<li>מעבירים את הסופרנאטנט לצינור חדש וחוזרים על הצנטריפוגה למשך 15 דקות. מעבירים את הסופרנאטנט המפונה לצינור אחר.</li>
		<li>סננו את הסופרנאטנט דרך מסנן של 0.22 מיקרומטר (ראו טבלת חומרים) לקבלת תמצית חלבון מסיס לחלוטין.</li>
	</ol></li>
</ol>  
6. טיהור GFP-His עם כרומטוגרפיית זיקה ניקל (Ni)
הערה: בצע את כל השלבים בטמפרטורה של 4°C.
<ol><li>הוסף Ni sepharose excel resin (ראה טבלת חומרים) לצינור ביחס של 1:1000 ביחס לנפח תמצית החלבון משלב 5.1.6. נפח השרף שווהל-1 /1000 מנפח תמצית החלבון.</li>
	<li>שטפו את שרף Ni 3x עם נפח שרף פי 10 של ddH2O ו-PB (pH 7.0) בנפרד בתורו והסירו את הסופרנטנט.</li>
	<li>יש לדגור על תמצית חלבון עם שרף Ni למשך שעתיים כדי לאפשר קשירה מלאה. צנטריפוגה ב 500 x גרם במשך 5 דקות כדי להסיר חלבונים לא קשורים בסופרנטנט. יש לשטוף פי 3 עם נפח שרף פי 20 של PB. צנטריפוגה ב 500 x גרם במשך 5 דקות ולהסיר את supernatant.</li>
	<li>Elute GFP-His על ידי הוספת נפח שרף 10x של 250 mM imidazole (50 mM Tris-HCl pH 7.4, 150 mM NaCl, 10% glycerol, 250 mM imidazole) ולאסוף את supernatant.</li>
</ol>7. כתמים כחולים של חלבונים
<ol><li>הוסף 10 μL של מאגר טעינה 5x SDS ל 40 μL של דגימות חלבון, להרתיח במשך 10 דקות, ולאחר מכן לרוץ על 15% SDS-PAGE ב 110 V במשך 60 דקות.</li>
	<li>ג'ל חלבון מכתים עם תמיסה כחולה קומאסי (0.1% R-250, 25% איזופרופנול, 10% חומצה אצטית קרחונית) למשך שעתיים.</li>
	<li>יוצקים את התמיסה ושוטפים בתמיסת הסרת צבע למשך שעתיים. שימו לב לג'ל; חלבונים על הג'ל יהיו בצבע כחול.</li>
</ol>8. כתם מערבי של חלבונים
<ol><li>הוסף 10 μL של מאגר טעינה 5x SDS ל 40 μL של דגימות חלבון, להרתיח במשך 10 דקות, ולאחר מכן לרוץ על 15% SDS-PAGE ב 110 V במשך 60 דקות.</li>
	<li>העברת חלבונים לקרום ניטרוצלולוז של 0.45 מיקרומטר ב-280 mA. לחסום את הממברנה עם חלב דל שומן 5% במשך 1 שעות.</li>
	<li>לדלל את הנוגדנים anti-His-tag ב 1:5000 ולדגור את הממברנה עם הנוגדנים במשך 1 שעות. השתמשו במי מלח חוצצים בתלת-מלח וב-tween 20 (TBST) כדי לשטוף את הממברנה 4x למשך 5 דקות.</li>
	<li>לדלל את הנוגדנים נגד עכבר ב 1:10000 ולדגור את הממברנה עם הנוגדנים במשך 1 שעות. השתמשו ב-TBST כדי לשטוף את הממברנה 4x במשך 5 דקות.</li>
	<li>ערבבו את המפתח (ראו טבלת חומרים) ביחס של 1:1. הוסף 400 μL לממברנה ולאפשר להגיב במשך 1 דקה. צלם תמונות לאחר חשיפה של דקה אחת באמצעות חומר הדמיה.</li>
</ol>9. בדיקת ריכוז חלבון
<ol><li>הוסף 5 μL של חלבון ל 1 מ"ל של Bradford 1x מגיב צבע ולהגיב במשך 5 דקות.</li>
	<li>קבע את ערך OD595 לאחר אפס וחשב את ריכוז החלבון מהעקומה הסטנדרטית.</li>
</ol>10. כימות חלבונים 31
<ol><li>ביצוע הדבקה מערבית של דגימות חלבון יחד עם תקנים.</li>
	<li>בצע כימות של GFP לפי יחס לתקנים באמצעות ניתוח גווני אפור של ImageJ 1.5.0.</li>
</ol>

מיצוי וטיהור יעיל של GFP-His מעלי N. benthamiana

<ol>
	<li>Zahmanova, G., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Green+biologics:+Harnessing+the+power+of+plants+to+produce+pharmaceuticals.">Green biologics: Harnessing the power of plants to produce pharmaceuticals.</a> Int J Mol Sci. 24 (24), 1757 (2023).</li><li>PREVAIL Writing Group. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=A+randomized,+controlled+trial+of+ZMapp+for+Ebola+virus+infection.">A randomized, controlled trial of ZMapp for Ebola virus infection.</a> N Engl J Med. 375 (15), 1448-1456 (2016).</li><li>Ma, J. K. C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Regulatory+approval+and+a+first-in-human+phase+I+clinical+trial+of+a+monoclonal+antibody+produced+in+transgenic+tobacco+plants.">Regulatory approval and a first-in-human phase I clinical trial of a monoclonal antibody produced in transgenic tobacco plants.</a> Plant Biotechnol J. 13 (8), 1106-1120 (2015).</li><li>Shanmugaraj, B., Rattanapisit, K., Manopwisedjaroen, S., Thitithanyanont, A., Phoolcharoen, W. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Monoclonal+antibodies+B38+and+H4+produced+in+Nicotiana+benthamiana+neutralize+SARS-CoV-2+in+vitro.">Monoclonal antibodies B38 and H4 produced in Nicotiana benthamiana neutralize SARS-CoV-2 in vitro.</a> Front Plant Sci. 11, 589995 (2020).</li><li>Takeyama, N., Kiyono, H., Yuki, Y. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Plant-based+vaccines+for+animals+and+humans:+Recent+advances+in+technology+and+clinical+trials.">Plant-based vaccines for animals and humans: Recent advances in technology and clinical trials.</a> Ther Adv Vaccines. 3 (5-6), 139-154 (2015).</li><li>Ward, B. J., S&#233;guin, A., Couillard, J., Tr&#233;panier, S., Landry, N. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Phase+III:+Randomized+observer-blind+trial+to+evaluate+lot-to-lot+consistency+of+a+new+plant-derived+quadrivalent+virus+like+particle+influenza+vaccine+in+adults+18-49+years+of+age.">Phase III: Randomized observer-blind trial to evaluate lot-to-lot consistency of a new plant-derived quadrivalent virus like particle influenza vaccine in adults 18-49 years of age.</a> Vaccine. 39 (10), 1528-1533 (2021).</li><li>Siriwattananon, K., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Plant-produced+receptor-binding+domain+of+SARS-CoV-2+elicits+potent+neutralizing+responses+in+mice+and+non-human+primates.">Plant-produced receptor-binding domain of SARS-CoV-2 elicits potent neutralizing responses in mice and non-human primates.</a> Front Plant Sci. 12, 682953 (2021).</li><li>Leblanc, Z., Waterhouse, P., Bally, J. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Plant-based+vaccines:+The+way+ahead.">Plant-based vaccines: The way ahead.</a> Viruses. 13 (1), 5 (2020).</li><li>Sethi, L., Kumari, K., Dey, N. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Engineering+of+plants+for+efficient+production+of+therapeutics.">Engineering of plants for efficient production of therapeutics.</a> Mol Biotechnol. 63 (12), 1125-1137 (2021).</li><li>Webster, D. E., Thomas, M. C. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Post-translational+modification+of+plant-made+foreign+proteins;+glycosylation+and+beyond.">Post-translational modification of plant-made foreign proteins; glycosylation and beyond.</a> Biotechnol Adv. 30 (2), 410-418 (2012).</li><li>Streatfield, S. J. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Approaches+to+achieve+high-level+heterologous+protein+production+in+plants.">Approaches to achieve high-level heterologous protein production in plants.</a> Plant Biotechnol J. 5 (1), 2-15 (2007).</li><li>Nandi, S., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Process+development+and+economic+evaluation+of+recombinant+human+lactoferrin+expressed+in+rice+grain.">Process development and economic evaluation of recombinant human lactoferrin expressed in rice grain.</a> Transgenic Res. 14 (3), 237-249 (2005).</li><li>Ullrich, K. K., Hiss, M., Rensing, S. A. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Means+to+optimize+protein+expression+in+transgenic+plants.">Means to optimize protein expression in transgenic plants.</a> Curr Opin Biotechnol. 32, 61-67 (2015).</li><li>Su, H., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Plant-made+vaccines+against+viral+diseases+in+humans+and+farm+animals.">Plant-made vaccines against viral diseases in humans and farm animals.</a> Front Plant Sci. 14, 1170815 (2023).</li><li>Agrawal, G. K., Jwa, N. S., Lebrun, M. H., Job, D., Rakwal, R. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Plant+secretome:+Unlocking+secrets+of+the+secreted+proteins.">Plant secretome: Unlocking secrets of the secreted proteins.</a> Proteomics. 10 (4), 799-827 (2010).</li><li>Kim, T., Gondr&#233;-Lewis, M. C., Arnaoutova, I., Loh, Y. P. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Dense-core+secretory+granule+biogenesis.">Dense-core secretory granule biogenesis.</a> Physiology. 21, 124-133 (2006).</li><li>Menkhaus, T. J., Bai, Y., Zhang, C., Nikolov, Z. L., Glatz, C. E. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Considerations+for+the+recovery+of+recombinant+proteins+from+plants.">Considerations for the recovery of recombinant proteins from plants.</a> Biotechnol Prog. 20 (4), 1001-1014 (2004).</li><li>Kim, S. T., Cho, K. S., Jang, Y. S., Kang, K. Y. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Two-dimensional+electrophoretic+analysis+of+rice+proteins+by+polyethylene+glycol+fractionation+for+protein+arrays.">Two-dimensional electrophoretic analysis of rice proteins by polyethylene glycol fractionation for protein arrays.</a> Electrophoresis. 22 (10), 2103-2109 (2001).</li><li>Xi, J., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Polyethylene+glycol+fractionation+improved+detection+of+low-abundant+proteins+by+two-dimensional+electrophoresis+analysis+of+plant+proteome.">Polyethylene glycol fractionation improved detection of low-abundant proteins by two-dimensional electrophoresis analysis of plant proteome.</a> Phytochemistry. 67 (21), 2341-2348 (2006).</li><li>Dani, V., Simon, W. J., Duranti, M., Croy, R. R. D. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Changes+in+the+tobacco+leaf+apoplast+proteome+in+response+to+salt+stress.">Changes in the tobacco leaf apoplast proteome in response to salt stress.</a> Proteomics. 5 (3), 737-745 (2005).</li><li>Delaunois, B., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Uncovering+plant-pathogen+crosstalk+through+apoplastic+proteomic+studies.">Uncovering plant-pathogen crosstalk through apoplastic proteomic studies.</a> Front Plant Sci. 5, 249 (2014).</li><li>Andreasson, E., Abreha, K. B., Resj&#246;, S. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Isolation+of+apoplast.">Isolation of apoplast.</a> Methods Mol. Biol. 1511, 233-240 (2017).</li><li>Lohaus, G., Pennewiss, K., Sattelmacher, B., Hussmann, M., Hermann, M. K. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Is+the+infiltration-centrifugation+technique+appropriate+for+the+isolation+of+apoplastic+fluid?+A+critical+evaluation+with+different+plant+species.">Is the infiltration-centrifugation technique appropriate for the isolation of apoplastic fluid? A critical evaluation with different plant species.</a> Physiol Plant. 111 (4), 457-465 (2001).</li><li>Nouchi, I., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Overcoming+the+difficulties+in+collecting+apoplastic+fluid+from+rice+leaves+by+the+infiltration-centrifugation+method.">Overcoming the difficulties in collecting apoplastic fluid from rice leaves by the infiltration-centrifugation method.</a> Plant Cell Physiol. 53 (9), 1659-1668 (2012).</li><li>Rumyantseva, N. I., Valieva, A. I., Kostyukova, Y. A., Ageeva, M. V. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+effect+of+leaf+plasticity+on+the+isolation+of+apoplastic+fluid+from+leaves+of+tartary+buckwheat+plants+grown+in+vivo+and+in+vitro.">The effect of leaf plasticity on the isolation of apoplastic fluid from leaves of tartary buckwheat plants grown in vivo and in vitro.</a> Plants. 12 (23), 4048 (2023).</li><li>Ekanayake, G., Gohmann, R., Mackey, D. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=A+method+for+quantitation+of+apoplast+hydration+in+Arabidopsis+leaves+reveals+water-soaking+activity+of+effectors+of+Pseudomonas+syringae+during+biotrophy.">A method for quantitation of apoplast hydration in Arabidopsis leaves reveals water-soaking activity of effectors of Pseudomonas syringae during biotrophy.</a> Sci Rep. 12 (1), 18363 (2022).</li><li>Preston, G. M., Fones, H. N., Mccraw, S., Rico, A., O'leary, B. M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+infiltration-centrifugation+technique+for+extraction+of+apoplastic+fluid+from+plant+leaves+using+phaseolus+vulgaris+as+an+example.">The infiltration-centrifugation technique for extraction of apoplastic fluid from plant leaves using phaseolus vulgaris as an example.</a> J Vis Exp. (94), e52113 (2014).</li><li>Nandi, S., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Process+development+and+economic+evaluation+of+recombinant+human+lactoferrin+expressed+in+rice+grain.">Process development and economic evaluation of recombinant human lactoferrin expressed in rice grain.</a> Transgenic Res. 14 (3), 237-249 (2005).</li><li>Menkhaus, T. J., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Considerations+for+the+recovery+of+recombinant+proteins+from+plants.">Considerations for the recovery of recombinant proteins from plants.</a> Biotechnol Prog. 20 (4), 1001-1014 (2004).</li><li>Streatfield, S. J. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Approaches+to+achieve+high-level+heterologous+protein+production+in+plants.">Approaches to achieve high-level heterologous protein production in plants.</a> Plant Biotechnol J. 5 (1), 2-15 (2007).</li><li>Yamamoto, T., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Improvement+of+the+transient+expression+system+for+production+of+recombinant+proteins+in+plants.">Improvement of the transient expression system for production of recombinant proteins in plants.</a> Sci Rep. 8 (1), 4755 (2018).</li><li>Zhao, J., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Wheat+Apoplast-localized+lipid+transfer+protein+TaLTP3+enhances+defense+responses+against+Puccinia+triticina.">Wheat Apoplast-localized lipid transfer protein TaLTP3 enhances defense responses against Puccinia triticina.</a> Front Plant Sci. 12, 771806 (2021).</li><li>Venkataraman, S., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Recent+advances+in+expression+and+purification+strategies+for+plant+made+vaccines.">Recent advances in expression and purification strategies for plant made vaccines.</a> Front Plant Sci. 14, 1273958 (2023).</li><li>Witzel, K., Shahzad, M., Matros, A., Mock, H. P., M&#252;hling, K. H. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Comparative+evaluation+of+extraction+methods+for+apoplastic+proteins+from+maize+leaves.">Comparative evaluation of extraction methods for apoplastic proteins from maize leaves.</a> Plant Meth. 7, 48 (2011).</li></ol>

המחברים מצהירים כי אין ניגוד עניינים.

השימוש בצמחים לייצור חלבונים טיפוליים התרחב במהירות בשנים האחרונות 1,2,3,4,5,6. גנים מקודדי חלבונים משובטים לווקטורי ביטוי ומועברים לרקמות הצמח באמצעות חדירה חקלאית. לאחר הייצור על י?...

כיום, חלבונים טיפוליים רקומביננטיים שונים המיוצרים על ידי צמחים נחקרים, כולל נוגדנים, חיסונים, חלבונים ביו-אקטיביים, אנזימים ופוליפפטידים קטנים 1,2,3,4,5,6. צמחים הופכים לפלטפורמה מנוצלת יותר ויותר לייצור חלבונים טיפוליים בשל בטיחותם, עלותם הנמוכה ויכולתם להגדיל במהירות את הייצור 7,8. ביטוי ושינוי חלבונים במערכות צמחיות, יחד עם טיהור חלבונים, הם גורמים קריטיים הקובעים את התפוקה של ביוריאקטורים צמחיים 9,10. שיפור הפרודוקטיביות של הצמח והשגת חלבוני מטרה בעלי טוהר גבוה הם אתגרי הליבה העומדים בפני מערכות ייצור צמחיות11,12.
הלוקליזציה התת-תאית והשינוי של חלבונים רקומביננטיים תלויים בפפטיד האות הספציפי המקודד ב-N-terminus, אשר מכוון את החלבון ליעדו הסופי במהלך ביטוי הגנים. חלבונים רקומביננטיים מתוכננים למקם את האפופלסט, הרשתית האנדופלסמית (ER), הכלורופלסט, הוואקול או הציטופלסמה, בהתבסס על תכונותיהם הייחודיות13. עבור אנטיגנים ונוגדנים, חלבונים מופרשים עדיפים. לפני ההפרשה, חלבונים מתקדמים דרך ER ו Golgi עבור קיפול נכון ושינויים לאחר תרגום 14,15,16.
לאחר הייצור בצמחים, חלבונים רקומביננטיים חייבים להיות מטוהרים מתמציות צמחים. בדרך כלל, חלבונים מטוהרים מתמציות צמחים מסיסות, המכילות שפע של חלבונים תוך-תאיים, מוצרים שלא קופלו כהלכה ולא שונו, וציטוכרומים17. כדי להסיר זיהומים, תמציות צמחים עוברות שבירה נרחבת, כולל כרומטוגרפיית זיקה ספציפית לריבולוז-1,5-ביספוספט קרבוקסילאז/אוקסיגנאז (RuBisCO), משקעים פיטאטים, משקעים מפוליאתילן גליקול והתאמת טמפרטורה ו- pH18,19. שלבים כאלה של הסרת זיהומים הם מייגעים ועלולים לפגוע באיכות החלבון.
תא התא הצמחי מעבר לקרום הפלזמה מוגדר כאפופלסט, וכולל את דופן התא, חללים בין-תאיים וקסילם20. הפאזה המימית נקראת בדרך כלל נוזל כביסה אפופלסט (AWF). AWF מכיל מולקולות המופרשות על ידי תאים כדי לווסת התקדמות ביולוגית רבה כמו תחבורה, מטבוליזם של דופן התא ותגובות לחץ21,22. בניגוד ל-TSP, המרכיבים המולקולריים של AWF פחות מורכבים. חילוץ חלבונים רקומביננטיים מ-AWF עשוי למנוע זיהום על ידי חלבונים תוך-תאיים, מוצרים שאינם מקופלים כהלכה ושאריות ציטופלזמיות. בקצרה, שומני מיצוי נכנסים לעלים דרך הפיוניות בלחץ שלילי, וה- AWF נאסף על ידי צנטריפוגה עדינה23. בעוד בידוד של AWF נמצא בשימוש נרחב כדי לחקור את ההתקדמות הביולוגית בתוך אפופלסט 24,25,26,27, הוא לא נוצל במערכות ייצור צמחיות.
שיפור התפוקה של המפעל והשגת חלבוני מטרה בעלי טוהר גבוה הם אתגרים מרכזיים עבור מערכות ייצור צמחים28. בדרך כלל, חלבונים מטוהרים מתמציות צמחים מסיסים הכוללים כמויות גדולות של חלבונים תוך-תאיים, מוצרים שאינם מקופלים כהלכה וללא שינוי, וציטוכרומים29, הדורשים עלויות גדולות לטיהור הבא30. השימוש בשיטות מיצוי חלבוני AWF למיצוי חלבונים רקומביננטיים אקסוגניים המופרשים לאפופלסט יכול לשפר ביעילות את ההומוגניות של חלבונים רקומביננטיים ולהפחית את עלות טיהור החלבונים. כאן, אנו משתמשים בפפטיד אות PR1a כדי לאפשר הפרשת חלבון אקסוגני לתוך חלל אפופלסט ומציגים שיטה מפורטת לטיהור חלבון רקומביננטי מה- AWF של N. benthamiana.

<table border="1" fo:keep-together.within-page="1" fo:keep-with-next.within-page="always">
	<tbody>
		<tr>
			<td>100 mesh nylon fine mesh yarn</td>
			<td>Guangzhou Huayu Trading limited company</td>
			<td>hy-230724-2</td>
			<td>For AWF protein extraction</td>
		</tr>
		<tr>
			<td>50 ml centrifuge tubes</td>
			<td>Vazyme</td>
			<td>TCF00150</td>
			<td>For centrifuge</td>
		</tr>
		<tr>
			<td>ClonExpress II one step cloning kit</td>
			<td>Vazyme</td>
			<td>C112-02</td>
			<td>For clone</td>
		</tr>
		<tr>
			<td>FastDigest Sac1</td>
			<td>NEB</td>
			<td>R3156S</td>
			<td>For clone</td>
		</tr>
		<tr>
			<td>FastDigest XbaI</td>
			<td>NEB</td>
			<td>FD0685</td>
			<td>For clone</td>
		</tr>
		<tr>
			<td>ImageJ 1.5.0</td>
			<td>/</td>
			<td>/</td>
			<td>For greyscale analysis</td>
		</tr>
		<tr>
			<td>Large filter</td>
			<td>Thermo Fisher</td>
			<td>NEST</td>
			<td>For filtering</td>
		</tr>
		<tr>
			<td>Laser scanning confocal microscopy</td>
			<td>Leica SP8</td>
			<td></td>
			<td>For subcellular localization</td>
		</tr>
		<tr>
			<td>Ni sepharose excel</td>
			<td>Cytiva</td>
			<td>10339806</td>
			<td>For protein purification</td>
		</tr>
		<tr>
			<td>Precast protein plus gel</td>
			<td>YEASEN</td>
			<td>36246ES10</td>
			<td>For SDS-PAGE</td>
		</tr>
		<tr>
			<td>Small filter</td>
			<td>Nalgene</td>
			<td>1660045</td>
			<td>For filtering</td>
		</tr>
		<tr>
			<td>SuperSignal West Femto Substrate Trial Kit</td>
			<td>Thermo Fisher</td>
			<td>34076</td>
			<td>For western blotting</td>
		</tr>
		<tr>
			<td>Triton X-100</td>
			<td>SCR</td>
			<td>30188928</td>
			<td>To configure the extraction buffer</td>
		</tr>
		<tr>
			<td>Type rotaryvang vacuum pump</td>
			<td>Zhejiang taizhouqiujing vacuum pump limited company</td>
			<td>2XZ-2</td>
			<td>For vacuum infiltration</td>
		</tr>
		<tr>
			<td>Vertical mixer</td>
			<td>Haimen Qilinbel Instrument Manufacturing limited company</td>
			<td>BE-1200</td>
			<td>For mixing</td>
		</tr>
		<tr>
			<td>&#946;-mercaptoethanol</td>
			<td>SIGMA</td>
			<td>BCBK8223V</td>
			<td>To configure the extraction buffer</td>
		</tr>
	</tbody>
</table>

apoplast-extraction based method to improve the purity of plant produced recombinant protein  

צמחים הם מערכת ביטוי אאוקריוטית חדשה שמתפתחת ונחקרת כדי לייצר חלבונים טיפוליים. טיהור חלבונים רקומביננטיים מצמחים הוא אחד השלבים הקריטיים ביותר בתהליך הייצור. בדרך כלל, חלבונים טוהרו מחלבונים מסיסים כוללים (TSP), ונוכחותם של חלבונים תוך-תאיים וציטוכרומים שונים מציבה אתגרים לשלבי טיהור החלבונים הבאים. יתר על כן, רוב החלבונים הטיפוליים כמו אנטיגנים ונוגדנים מופרשים כדי להשיג גליקוזילציה נכונה, ונוכחות של חלבונים שהשתנו באופן לא מלא מובילה לאנטיגן או מבני נוגדנים לא עקביים. עבודה זו מציגה שיטה יעילה יותר להשגת חלבונים רקומביננטיים מטוהרים מאוד מהחלל האפופלסטי של הצמח. החלבון הפלואורסצנטי הירוק הרקומביננטי (GFP) מהונדס להיות מופרש לתוך אפופלסט של ניקוטיאנה בנטמיאנה ולאחר מכן מופק בשיטת חדירה-צנטריפוגה. ה-GFP-His מהאפופלסט המופק מטוהר לאחר מכן על ידי כרומטוגרפיית זיקה לניקל. בניגוד לשיטות המסורתיות של TSP, טיהור מהאפופלסט מייצר חלבונים רקומביננטיים מטוהרים מאוד. מדובר בשיפור טכנולוגי חשוב למערכות הייצור במפעלים.

Nowadays, various plant-produced recombinant therapeutic proteins are under study, including antibodies, vaccines, bioactive proteins, enzymes, and small polypeptides1,2,3,4,5,6. Plants are becoming an increasingly utilized platform for producing therapeutic proteins due to their safety, low cost, and ability to rapidly scale production7,8. Protein expression and modification in plant systems, along with protein purification, are critical factors determining the productivity of plant bioreactors9,10. Enhancing plant productivity and obtaining high-purity target proteins are core challenges facing plant-based production systems11,12.
The subcellular localization and modification of recombinant proteins depends on the specific signal peptide encoded at the N-terminus, which targets the protein to its final organelle destination during gene expression. Recombinant proteins are designed to localize to the apoplast, endoplasmic reticulum (ER), chloroplast, vacuole, or cytoplasm, based on their unique properties13. For antigens and antibodies, secreted proteins are preferred. Before secretion, proteins progress through ER and Golgi for correct folding and post-translational modifications14,15,16.
After production in plants, recombinant proteins must be purified from plant extracts. Typically, proteins are purified from total soluble plant extracts, which contain abundant intracellular proteins, misfolded and unmodified products, and cytochromes17. To remove impurities, plant extracts undergo extensive fractionation, including ribulose-1,5-bisphosphate carboxylase/oxygenase (RuBisCO)-specific affinity chromatography, phytate precipitation, polyethylene glycol precipitation, and adjustment of temperature and pH18,19. Such impurity-removal steps are laborious and can compromise protein quality.
The plant cell compartment beyond the plasma membrane is defined as the apoplast, encompassing the cell wall, intercellular spaces, and xylem20. The aqueous phase is commonly called apoplast washing fluid (AWF). AWF contains molecules secreted by cells to regulate numerous biological progresses like transport, cell wall metabolism, and stress responses21,22. In contrast to TSP, the molecular constituents of AWF are less complex. Extracting recombinant proteins from AWF may avoid contamination by intracellular proteins, misfolded products, and cytoplasmic remnants. Briefly, extraction lipid enters leaves through the stomata under negative pressure, and the AWF is collected by gentle centrifugation23. While isolation of AWF is widely employed to study the biological progress inside apoplast24,25,26,27, it has not been exploited in plant-based production systems.
Improving plant productivity and obtaining high purity target proteins are central challenges for plant production systems28. Typically, proteins are purified from total soluble plant extracts containing large amounts of intracellular proteins, misfolded and unmodified products, and cytochromes29, which require great costs for subsequent purification30. The use of AWF protein extraction methods for the extraction of exogenous recombinant proteins secreted into apoplast can effectively improve the homogeneity of recombinant proteins and reduce the cost of protein purification. Here, we use a signal peptide PR1a to enable exogenous protein secretion into the apoplast space and introduce a detailed method for recombinant protein purification from the AWF of N. benthamiana.

מחבר זרקור: אופטימיזציה של מיצוי חלבון אפופלסט להתאוששות יעילה של חלבונים רקומביננטיים מתאי צמח

שיטה מבוססת מיצוי אפופלסט לשיפור הטוהר של חלבון רקומביננטי המיוצר על ידי צמחים  

We investigated how to extract recombinant proteins from plant cells more efficiently. We answered the question of whether the apoplast protein extraction method is feasible when applied to the recombinant proteins. This extraction method extracts proteins secreted into the apoplast, so they have homogeneity.There is no need for cell disruption, which reduce the interference from intracellular proteins and the subsequent purification costs. We will focus on how to increase the secretion of recombinant proteins in the apoplast space to further improve the efficiency of the apoplast protein extraction method.

GFP-His מיועד להפרשה לחלל האפופלסטי של N. benthamiana GFP שובט לתוך פלסמיד pCAMBIA1300 עם פפטיד אות N-terminal PR1a להפרשה ותג His-terminal C לטיהור, ויצר p35s-PR1a-GFP-His (איור 1A). החלבון הרקומביננטי בוטא באופן ארעי ב-N. benthamiana ורצועה של 30 kDa זוהתה על-ידי כתם מערבי באמצעות נוגדן אנטי-...

טיהור חלבונים רקומביננטיים ממערכות צמחיות מאותגר בדרך כלל על ידי חלבונים צמחיים. עבודה זו מספקת שיטה למיצוי וטיהור יעיל של חלבון רקומביננטי מופרש מהאפופלסט של ניקוטיאנה בנתמיאנה.

Plants are a newly developing eukaryotic expression system being explored to produce therapeutic proteins. Purification of recombinant proteins from ...

apoplast-extraction-based-method-to-improve-purity-plant-produced

Research

JoVE Journal

Biology

Apoplast-Extraction Based Method to Improve the Purity of Plant Produced Recombinant Protein  

672 Views.  Shandong First Medical University. חקרנו כיצד לחלץ חלבונים רקומביננטיים מתאי צמחים בצורה יעילה יותר. ענינו על השאלה האם שיטת מיצוי החלבונים אפופלסט ישימה כאשר היא מיושמת על החלבונים הרקומביננטיים. שיטת מיצוי זו מחלצת חלבונים המופרשים לאפופלסט, כך שיש להם הומוגניות.אין צורך בהפרעה לתא...

Video: מחבר זרקור: אופטימיזציה של מיצוי חלבון אפופלסט להתאוששות יעילה של חלבונים רקומביננטיים מתאי צמח

Plants are a newly developing eukaryotic expression system being explored to produce therapeutic proteins. Purification of recombinant proteins from plants is one of the most critical steps in the production process. Typically, proteins were purified from total soluble proteins (TSP), and the presence of miscellaneous intracellular proteins and cytochromes poses challenges for subsequent protein purification steps. Moreover, most therapeutic proteins like antigens and antibodies are secreted to obtain proper glycosylation, and the presence of incompletely modified proteins leads to inconsistent antigen or antibody structures. This work introduces a more effective method to obtain highly purified recombinant proteins from the plant apoplastic space. The recombinant Green fluorescent protein (GFP) is engineered to be secreted into the apoplast of Nicotiana benthamiana and is then extracted using an infiltration-centrifugation method. The GFP-His from the extracted apoplast is then purified by nickel affinity chromatography. In contrast to the traditional methods from TSP, purification from the apoplast produces highly purified recombinant proteins. This represents an important technological improvement for plant production systems.

The purification of recombinant proteins from plant systems is usually challenged by plant proteins. This work provides a method to effectively extract and purify a secreted recombinant protein from the apoplast of Nicotiana benthamiana.

Extraction and Purification of a Secreted Recombinant Protein from the Apoplast of Nicotiana benthamiana

To observe subcellular localization of GFP, after 48 hours of agroinfiltration of Nicotiana benthamiana, select a flat leaf and make a six-millimeter hole using a hole punch. Drip 30%sucrose solution onto a glass slide. Place the leaf sample with the back facing upwards, and cover it with a cover glass.Collect the intact, fresh N.benthamiana leaves expressing recombinant GFP at three days post-agroinfiltration, and weigh the leaves. Rinse the leaf blade with pre-cooled, sterilized, double-distilled water to remove debris. Submerge 20 grams with the abaxial side down in 500 milliliters of pre-cooled 100-millimolar phosphate buffer in a 1, 000 milliliter wide-mouth beaker.Cover the leaves with 100 mesh nylon, fine mesh yarn and a plastic plate. Connect the beaker to a vacuum pump. Apply 0.8 megapascal vacuum for one minute, then quickly restore to atmospheric pressure.Remove leaves from the buffer and gently blot dry with absorbent paper. Roll up the leaves and wrap them with mesh yarn. For collecting apoplastic washing fluid, or AWF, position rolled leaves tip-side up in 50-milliliter centrifuge tubes with mesh yarn fastened by the tube caps.Centrifuge the leaves at 500g for five minutes at four degrees Celsius. Remove the leaves and collect AWF using a pipette. Add Nickel Sepharose excel resin to a tube in a one-to-1, 000 ratio relative to the protein extract volume.Wash nickel resin three times with 10 times the resin volume of double-distilled water and phosphate buffer separately, in turn. Incubate protein extract with nickel resin for two hours to allow full binding. Then, centrifuge at 500g for five minutes at four degrees Celsius to remove unbound proteins in the supernatant.Wash three times with 20 times the resin volume of phosphate buffer. After the last wash, add 10 times the resin volume of 250 millimolar imidazole to elute GFPs. Centrifuge the mixture at 500g for five minutes at four degrees Celsius, and collect the supernatant.Western blot analysis confirmed the transient expression of 30 kilodalton recombinant protein GFPs in N.benthamiana. Fluorescence microscopy illustrated the presence of GFPs within the apoplast. AWF proteins extracted by vacuum infiltration centrifugation also contained GFPs.Out of the eight extraction solutions tested, phosphate buffer extracted the greatest amount of AWF and GFPs. Comparing phosphate buffer at varying pH revealed improved AWF and GFPs extraction at neutral to mildly alkaline conditions. Additionally, 100 millimolar phosphate buffer showed maximal efficacy for recovering AWF and GFPs.With a 100-millimolar phosphate buffer, 495 micrograms of total AWF proteins per gram of fresh leaf were recovered from the apoplast. The extracted AWF contained 10 micrograms of GFPs, which corresponded to approximately 18%of the GFPs in the total soluble protein. Following nickel affinity chromatography, GFPs'purity reached 84.3%from AWF extraction, substantially higher than the 44.9%purity achieved through total soluble protein extraction.