Name: behavioral assessment of visual function via optomotor response and cognitive function via y-maze in diabetic rats
Uploaded: 2020-10-23T15:00:00
Description: Watch this Scientific Journal Video about Behavioral Assessment of Visual Function via Optomotor Response and Cognitive Function via Y-Maze in Diabetic Rats at JoVE.com

Diese Arbeit wurde durch die Department of Veterans Affairs Rehab R&D Service Career Development Awards (CDA-1, RX002111; CDA-2; RX002928) zu RSA und (CDA-2, RX002342) zu AJF und den National Institutes of Health (NIH-NICHD F31 HD097918 zu DACT und NIH-NIEHS T32 ES012870 zu DACT) und NEI Core Grant P30EY006360.

Alle Verfahren wurden vom Atlanta Veterans Affairs Institutional Animal Care and Use Committee genehmigt und entsprachen dem Leitfaden der National Institutes of Health für die Pflege und Verwendung von Labortieren (NIH Publications, 8. Auflage, aktualisiert 2011).
1. Die optomotorische Reaktion (OMR)
<ol><li>Einrichten des OMR-Geräts (Details zu Gerät und Software in der Materialtabelle)
	<ol>
<li>Wählen Sie die plattformgerechte Größe für das Nagetier: Ma...

<ol>
	<li>. International Diabetes Federation Diabetes Atlas, 9th edn Available from: <a target="_blank" href="https://diabetesatlas.org/upload/resources/material/20200302_133351_IDFATLAfinal-web.pdf">https://diabetesatlas.org/upload/resources/material/20200302_133351_IDFATLAfinal-web.pdf</a> (2019)</li><li>Wang, W., Lo, A. C. Y. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Diabetic+retinopathy:+pathophysiology+and+treatments.">Diabetic retinopathy: pathophysiology and treatments.</a> International Journal of Molecular Sciences. 19 (6), (2018).</li><li>Akpek, E. K., Smith, R. A. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Overview+of+age-related+ocular+conditions.">Overview of age-related ocular conditions.</a> The American Journal of Managed Care. 19 (5), 67-75 (2013).</li><li>Urano, F. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Wolfram+syndrome:+diagnosis,+management,+and+treatment.">Wolfram syndrome: diagnosis, management, and treatment.</a> Current Diabetes Reports. 16 (1), 6 (2016).</li><li>Adeva-Andany, M. M., Funcasta-Calder&#243;n, R., Fern&#225;ndez-Fern&#225;ndez, C., Ameneiros-Rodr&#237;guez, E., Dom&#237;nguez-Montero, A. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Subclinical+vascular+disease+in+patients+with+diabetes+is+associated+with+insulin+resistance.">Subclinical vascular disease in patients with diabetes is associated with insulin resistance.</a> Diabetes &amp; Metabolic Syndrome: Clinical Research &amp; Reviews. 13 (3), 2198-2206 (2019).</li><li>Chin, J. A., Sumpio, B. E. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Diabetes+mellitus+and+peripheral+vascular+disease:+diagnosis+and+management.">Diabetes mellitus and peripheral vascular disease: diagnosis and management.</a> Clinics in Podiatric Medicine and Surgery. 31 (1), 11-26 (2014).</li><li>Barber, A. J., Gardner, T. W., Abcouwer, S. F. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+significance+of+vascular+and+neural+apoptosis+to+the+pathology+of+diabetic+retinopathy.">The significance of vascular and neural apoptosis to the pathology of diabetic retinopathy.</a> Investigative Ophthalmology &amp; Visual Science. 52 (2), 1156-1163 (2011).</li><li>Pardue, M. T., Allen, R. S. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Neuroprotective+strategies+for+retinal+disease.">Neuroprotective strategies for retinal disease.</a> Progress in Retinal and Eye Research. 65, 50-76 (2018).</li><li>Aung, M. H., Kim, M. K., Olson, D. E., Thule, P. M., Pardue, M. T. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Early+visual+deficits+in+streptozotocin-induced+diabetic+long+evans+rats.">Early visual deficits in streptozotocin-induced diabetic long evans rats.</a> Investigative Ophthalmology &amp; Visual Science. 54 (2), 1370-1377 (2013).</li><li>Antonetti, D. A., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Diabetic+retinopathy:+seeing+beyond+glucose-induced+microvascular+disease.">Diabetic retinopathy: seeing beyond glucose-induced microvascular disease.</a> Diabetes. 55 (9), 2401-2411 (2006).</li><li>Logroscino, G., Kang, J. H., Grodstein, F. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Prospective+study+of+type+2+diabetes+and+cognitive+decline+in+women+aged+70-81+years.">Prospective study of type 2 diabetes and cognitive decline in women aged 70-81 years.</a> BMJ. 328 (7439), 548 (2004).</li><li>London, A., Benhar, I., Schwartz, M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+retina+as+a+window+to+the+brain-from+eye+research+to+CNS+disorders.">The retina as a window to the brain-from eye research to CNS disorders.</a> Nature Reviews Neurology. 9 (1), 44-53 (2013).</li><li>Archibald, N. K., Clarke, M. P., Mosimann, U. P., Burn, D. J. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+retina+in+Parkinson's+disease.">The retina in Parkinson's disease.</a> Brain. 132 (5), 1128-1145 (2009).</li><li>Sakai, R. E., Feller, D. J., Galetta, K. M., Galetta, S. L., Balcer, L. J. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Vision+in+multiple+sclerosis:+the+story,+structure-function+correlations,+and+models+for+neuroprotection.">Vision in multiple sclerosis: the story, structure-function correlations, and models for neuroprotection.</a> Journal of Neuroophthalmology. 31 (4), 362-373 (2011).</li><li>Wong, T. Y., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Retinal+microvascular+abnormalities+and+incident+stroke:+the+Atherosclerosis+Risk+in+Communities+Study.">Retinal microvascular abnormalities and incident stroke: the Atherosclerosis Risk in Communities Study.</a> The Lancet. 358 (9288), 1134-1140 (2001).</li><li>Marqui&#233;, M., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Association+between+retinal+thickness+and+&#946;-amyloid+brain+accumulation+in+individuals+with+subjective+cognitive+decline:+Fundaci&#243;+ACE+Healthy+Brain+Initiative.">Association between retinal thickness and &#946;-amyloid brain accumulation in individuals with subjective cognitive decline: Fundaci&#243; ACE Healthy Brain Initiative.</a> Alzheimer's Research &amp; Therapy. 12 (1), 37 (2020).</li><li>Thomas, B. B., Seiler, M. J., Sadda, S. R., Coffey, P. J., Aramant, R. B. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Optokinetic+test+to+evaluate+visual+acuity+of+each+eye+independently.">Optokinetic test to evaluate visual acuity of each eye independently.</a> Journal of Neuroscience Methods. 138 (1-2), 7-13 (2004).</li><li>Prusky, G. T., Alam, N. M., Beekman, S., Douglas, R. M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Rapid+quantification+of+adult+and+developing+mouse+spatial+vision+using+a+virtual+optomotor+system.">Rapid quantification of adult and developing mouse spatial vision using a virtual optomotor system.</a> Investigative Ophthalmology &amp; Vision Science. 45 (12), 4611-4616 (2004).</li><li>Maurice, T., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Behavioral+evidence+for+a+modulating+role+of+&#963;+ligands+in+memory+processes.+I.+Attenuation+of+dizocilpine+(MK-801)-induced+amnesia.">Behavioral evidence for a modulating role of &#963; ligands in memory processes. I. Attenuation of dizocilpine (MK-801)-induced amnesia.</a> Brain Research. 647 (1), 44-56 (1994).</li><li>Douglas, R. M., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Independent+visual+threshold+measurements+in+the+two+eyes+of+freely+moving+rats+and+mice+using+a+virtual-reality+optokinetic+system.">Independent visual threshold measurements in the two eyes of freely moving rats and mice using a virtual-reality optokinetic system.</a> Visual Neuroscience. 22 (5), 677-684 (2005).</li><li>Feola, A. J., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Menopause+exacerbates+visual+dysfunction+in+experimental+glaucoma.">Menopause exacerbates visual dysfunction in experimental glaucoma.</a> Experimental Eye Research. 186, 107706 (2019).</li><li>Allen, R. S., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=TrkB+signalling+pathway+mediates+the+protective+effects+of+exercise+in+the+diabetic+rat+retina.">TrkB signalling pathway mediates the protective effects of exercise in the diabetic rat retina.</a> European Journal of Neuroscience. 47 (10), 1254-1265 (2018).</li><li>Allen, R. S., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Retinal+deficits+precede+cognitive+and+motor+deficits+in+a+rat+model+of+type+II+diabetes.">Retinal deficits precede cognitive and motor deficits in a rat model of type II diabetes.</a> Investigative Ophthalmology &amp; Visual Science. 60 (1), 123-133 (2019).</li><li>Prusky, G. T., Harker, K. T., Douglas, R. M., Whishaw, I. Q. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Variation+in+visual+acuity+within+pigmented,+and+between+pigmented+and+albino+rat+strains.">Variation in visual acuity within pigmented, and between pigmented and albino rat strains.</a> Behavioural Brain Research. 136 (2), 339-348 (2002).</li><li>Hwang, C. K., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Circadian+rhythm+of+contrast+sensitivity+is+regulated+by+a+dopamine-neuronal+PAS-domain+protein+2-adenylyl+cyclase+1+signaling+pathway+in+retinal+ganglion+cells.">Circadian rhythm of contrast sensitivity is regulated by a dopamine-neuronal PAS-domain protein 2-adenylyl cyclase 1 signaling pathway in retinal ganglion cells.</a> Journal of Neuroscience. 33 (38), 14989-14997 (2013).</li><li>Mui, A. M., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Daily+visual+stimulation+in+the+critical+period+enhances+multiple+aspects+of+vision+through+BDNF-mediated+pathways+in+the+mouse+retina.">Daily visual stimulation in the critical period enhances multiple aspects of vision through BDNF-mediated pathways in the mouse retina.</a> PLoS One. 13 (2), 0192435 (2018).</li><li>Feola, A. J., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Menopause+exacerbates+visual+dysfunction+in+experimental+glaucoma.">Menopause exacerbates visual dysfunction in experimental glaucoma.</a> Experimental Eye Research. 186, 107706 (2019).</li><li>Allen, R. S., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Long-term+functional+and+structural+consequences+of+primary+blast+overpressure+to+the+eye.">Long-term functional and structural consequences of primary blast overpressure to the eye.</a> Journal of Neurotrauma. 35 (17), 2104-2116 (2018).</li><li>Maaswinkel, H., Li, L. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Spatio-temporal+frequency+characteristics+of+the+optomotor+response+in+zebrafish.">Spatio-temporal frequency characteristics of the optomotor response in zebrafish.</a> Vision Research. 43 (1), 21-30 (2003).</li><li>Benkner, B., Mutter, M., Ecke, G., M&#252;nch, T. A. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Characterizing+visual+performance+in+mice:+an+objective+and+automated+system+based+on+the+optokinetic+reflex.">Characterizing visual performance in mice: an objective and automated system based on the optokinetic reflex.</a> Behavioral Neuroscience. 127 (5), 788-796 (2013).</li><li>Lehmann, K., Schmidt, K. F., L&#246;wel, S. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Vision+and+visual+plasticity+in+ageing+mice.">Vision and visual plasticity in ageing mice.</a> Restorative Neurology and Neuroscience. 30, 161-178 (2012).</li><li>Leinonen, H., Tanila, H. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Vision+in+laboratory+rodents-tools+to+measure+it+and+implications+for+behavioral+research.">Vision in laboratory rodents-tools to measure it and implications for behavioral research.</a> Behavioral Brain Research. 352, 172-182 (2018).</li><li>Spielmann, M., Schr&#246;ger, E., Kotz, S. A., Pechmann, T., Bendixen, A. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Using+a+staircase+procedure+for+the+objective+measurement+of+auditory+stream+integration+and+segregation+thresholds.">Using a staircase procedure for the objective measurement of auditory stream integration and segregation thresholds.</a> Frontiers in Psychology. 4, 534 (2013).</li><li>Shi, C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Optimization+of+optomotor+response-based+visual+function+assessment+in+mice.">Optimization of optomotor response-based visual function assessment in mice.</a> Scientific Reports. 8 (1), 9708 (2018).</li><li>You, M., Yamane, T., Tomita, H., Sugano, E., Akashi, T. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=A+novel+rat+head+gaze+determination+system+based+on+optomotor+responses.">A novel rat head gaze determination system based on optomotor responses.</a> PLoS One. 12 (4), 0176633 (2017).</li><li>Whyte, A. J., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Reward-related+expectations+trigger+dendritic+spine+plasticity+in+the+mouse+ventrolateral+orbitofrontal+cortex.">Reward-related expectations trigger dendritic spine plasticity in the mouse ventrolateral orbitofrontal cortex.</a> The Journal of Neuroscience. 39 (23), 4595-4605 (2019).</li></ol>

Die OMR und das Y-Labyrinth ermöglichen die nicht-invasive Beurteilung von Sehfunktions- und kognitiven Funktionsdefiziten bei Nagetieren im Laufe der Zeit. In diesem Protokoll wurde gezeigt, dass die OMR und das Y-Labyrinth visuelle und kognitive Defizite in Nagetiermodellen von Diabetes verfolgen.
Kritische Schritte im Protokoll
Die OMR
Einige wichtige Punkte, die bei der Durchführung der OMR zur Beurteilung der visue...

An erratum was issued for:&#160;<a href="https://www.jove.com/t/61806">Behavioral Assessment of Visual Function via Optomotor Response and Cognitive Function via Y-Maze in Diabetic Rats</a>. The author list was updated.
The author list was updated from:
Kaavya Gudapati*1,2, Anayesha Singh*1,3, Danielle Clarkson-Townsend1,4, Andrew J. Feola1,2, Rachael S. Allen1,2 
1Center for Visual and Neurocognitive Rehabilitation, Atlanta VA Medical Center, 
2Department of Biomedical Engineering, Georgia Institute of Technology, 
3Department of Neuroscience, Emory University, 
4Gangarosa Department of Environmental Health, Emory University 
* These authors contributed equally
to:
Kaavya Gudapati*1,2, Anayesha Singh*1,3, Danielle Clarkson-Townsend1,4, Stephen Q. Phillips1, Amber Douglass1, Andrew J. Feola1,2, Rachael S. Allen1,2 
1Center for Visual and Neurocognitive Rehabilitation, Atlanta VA Medical Center, 
2Department of Biomedical Engineering, Georgia Institute of Technology, 
3Department of Neuroscience, Emory University, 
4Gangarosa Department of Environmental Health, Emory University 
* These authors contributed equally

An erratum was issued for:&#160;<a href="https://www.jove.com/t/61806">Behavioral Assessment of Visual Function via Optomotor Response and Cognitive Function via Y-Maze in Diabetic Rats</a>. The author list was updated.

Erratum: Behavioral Assessment of Visual Function via Optomotor Response and Cognitive Function via Y-Maze in Diabetic Rats

Über 463 Millionen Menschen leben mit Diabetes, was ihn zu einer der größten globalen Krankheitsepidemien macht1. Eine der schwerwiegenden Komplikationen, die sich aus Diabetes ergeben, ist die diabetische Retinopathie (DR), eine der Hauptursachen für Blindheit bei amerikanischen Erwachsenen im erwerbsfähigen Alter2. In den nächsten 30 Jahren wird sich der Prozentsatz der Bevölkerung, der für DR gefährdet ist, voraussichtlich verdoppeln, daher ist es von entscheidender Bedeutung, neue Wege zur Diagnose von DR in seinen früheren Stadien zu finden, um die DR-Entwicklung zu verhindern und zu mildern3. DR wurde herkömmlicherweise für eine Gefäßerkrankung gehalten4,5,6. Jetzt, mit Hinweisen auf neuronale Dysfunktion und Apoptose in der Netzhaut, die der vaskulären Pathologie vorausgeht, ist DR definiert, um neuronale und vaskuläre Komponenten zu haben4,5,6,7,8,9. Eine Möglichkeit, DR zu diagnostizieren, wäre die Untersuchung neuronaler Anomalien in der Netzhaut, einem Gewebe, das anfälliger für oxidativen Stress und metabolische Belastung durch Diabetes sein kann als anderes nervenaufreibendes Gewebe10.
Ein Rückgang der kognitiven und motorischen Funktion tritt auch bei Diabetes auf und korreliert oft mit Netzhautveränderungen. Ältere Personen mit Typ-II-Diabetes zeichnen sich durch eine schlechtere kognitive Leistungsfähigkeit zu Studienbeginn aus und zeigen einen stärkeren kognitiven Verfall als Kontrollteilnehmer11. Darüber hinaus wurde die Netzhaut als Erweiterung des zentralen Nervensystems etabliert und Pathologien können sich in der Netzhaut manifestieren12. Klinisch wurde die Beziehung zwischen Netzhaut und Gehirn im Zusammenhang mit Alzheimer und anderen Krankheiten untersucht, wird aber nicht häufig mit Diabetes untersucht12,13,14,15,16. Veränderungen im Gehirn und in der Netzhaut während des Fortschreitens von Diabetes können anhand von Tiermodellen untersucht werden, einschließlich der STZ-Ratte (ein Modell für Typ-I-Diabetes, bei dem das Toxin Streptozotocin oder STZ verwendet wird, um Betazellen der Bauchspeicheldrüse zu schädigen) und der Goto-Kakizaki-Ratte (ein polygenes Modell von Typ-II-Diabetes, bei dem Tiere im Alter von etwa 3 Wochen spontan eine Hyperglykämie entwickeln). In diesem Protokoll wird eine Beschreibung für das Y-Labyrinth und die optomotorische Reaktion zur Beurteilung kognitiver und visueller Veränderungen bei diabetischen Nagetieren gegeben. Die optomotorische Reaktion (OMR) bewertet die Ortsfrequenz (ähnlich der Sehschärfe) und die Kontrastempfindlichkeit, indem sie charakteristische reflexive Kopfverfolgungsbewegungen überwacht, um die visuellen Schwellenwerte für jedes Auge zu messen17. Die Ortsfrequenz bezieht sich auf die Dicke oder Feinheit der Balken, und die Kontrastempfindlichkeit bezieht sich darauf, wie viel Kontrast zwischen den Balken und dem Hintergrund besteht (Abbildung 1E). In der Zwischenzeit testet das Y-Labyrinth das räumliche Kurzzeitgedächtnis und die explorative Funktion, die durch spontane Wechsel und Eintritte durch die Arme des Labyrinths beobachtet werden.
Beide Tests können bei wachen, nicht betäubten Tieren durchgeführt werden und haben den Vorteil, dass sie aus den angeborenen Reaktionen der Tiere Kapital schlagen, was bedeutet, dass sie kein Training benötigen. Beide sind relativ empfindlich, da sie verwendet werden können, um Defizite früh im Fortschreiten von Diabetes bei Nagetieren zu erkennen, und zuverlässig, da sie Ergebnisse liefern, die mit anderen visuellen, netztinalen oder Verhaltenstests korrelieren. Darüber hinaus kann die Verwendung der OMR und des Y-Labyrinths in Verbindung mit Tests wie Elektroretinogramm- und optischen Kohärenztomographie-Scans Informationen darüber liefern, wann sich netzhautale, strukturelle und kognitive Veränderungen relativ zueinander in Krankheitsmodellen entwickeln. Diese Untersuchungen könnten nützlich sein, um neuronale Degenerationen zu identifizieren, die aufgrund von Diabetes auftreten. Letztendlich könnte dies zu neuen diagnostischen Methoden führen, die DR in frühen Stadien der Progression effektiv identifizieren.
Die OMR- und Y-Labyrinth-Systeme, die zur Entwicklung dieses Protokolls verwendet wurden, sind in der Materialtabelle beschrieben. Frühere Forschungen zur OMR von Prusky et al.18 und zum Y-Labyrinth von Maurice et al.19 wurden als Ausgangspunkt für die Entwicklung dieses Protokolls verwendet.

<table>
	<tbody>
		<tr>
			<td>OptoMotry HD</td>
			<td>CerebralMechanics Inc.</td>
			<td></td>
			<td>OMR apparatus &#38; software</td>
		</tr>
		<tr>
			<td>Timer</td>
			<td>Thomas Scientific</td>
			<td>810029AR</td>
			<td></td>
		</tr>
		<tr>
			<td>Y-Maze apparatus</td>
			<td>San Diego Instruments</td>
			<td>7001-043</td>
			<td>Available specifically for rats</td>
		</tr>
	</tbody>
</table>

behavioral assessment of visual function via optomotor response and cognitive function via y-maze in diabetic rats

Die optomotorische Reaktion und das Y-Labyrinth sind Verhaltenstests, die zur Beurteilung der visuellen bzw. kognitiven Funktion nützlich sind. Die optomotorische Reaktion ist ein wertvolles Werkzeug, um Veränderungen der Räumlichen Frequenz (SF) und kontrastempfindlichen (CS) Schwellenwerte im Laufe der Zeit in einer Reihe von Netzhauterkrankungsmodellen, einschließlich diabetischer Retinopathie, zu verfolgen. In ähnlicher Weise kann das Y-Labyrinth verwendet werden, um die räumliche Kognition (gemessen durch spontane Abwechslung) und das explorative Verhalten (gemessen an einer Reihe von Einträgen) in einer Reihe von Krankheitsmodellen zu überwachen, die das zentrale Nervensystem betreffen. Zu den Vorteilen der optomotorischen Reaktion und des Y-Labyrinths gehören Empfindlichkeit, Testgeschwindigkeit, die Verwendung angeborener Reaktionen (Training ist nicht erforderlich) und die Fähigkeit, an wachen (nicht betäubten) Tieren durchgeführt zu werden. Hier werden Protokolle sowohl für die optomotorische Reaktion als auch für das Y-Labyrinth beschrieben und Beispiele für ihre Verwendung in Modellen von Typ-I- und Typ-II-Diabetes gezeigt. Zu den Methoden gehören die Vorbereitung von Nagetieren und Ausrüstung, die Leistung der optomotorischen Reaktion und des Y-Labyrinths sowie die Datenanalyse nach dem Test.

Die OMR gilt als erfolgreich, wenn von einem Nagetier Räumliche Frequenz- und Kontrastempfindlichkeitsschwellenwerte erhalten werden können. Hier wird die Verwendung der OMR zur Beurteilung der Ortsfrequenz bei naiven Kontroll-Brown-Norway- und Long-Evans-Ratten veranschaulicht, beide jung (3–6 Monate) und gealtert (9–12 Monate). Braun-Norwegen-Ratten zeigen typischerweise eine höhere Ausgangs-Ortsfrequenz als Long-Evans-Ratten. Zusätzlich wurde bei den Long-Evans-Ratten ein Alterungseffekt auf die Ortsfrequenz b...

Watch this Scientific Journal Video about Behavioral Assessment of Visual Function via Optomotor Response and Cognitive Function via Y-Maze in Diabetic Rats at JoVE.com

Behavioral Assessment of Visual Function via Optomotor Response and Cognitive Function via Y-Maze in Diabetic Rats

Neuronale Degeneration in Augen und Gehirn als Folge von Diabetes kann durch Verhaltenstests an Nagetieren beobachtet werden. Das Y-Labyrinth, ein Maß für die räumliche Kognition, und die optomotorische Reaktion, ein Maß für die visuelle Funktion, geben beide Einblick in mögliche Diagnosen und Behandlungen.

Verhaltensbewertung der visuellen Funktion über optomotorische Reaktion und kognitive Funktion über Y-Maze bei diabetischen Ratten

The optomotor response and the Y-maze are behavioral tests useful for assessing visual and cognitive function, respectively. The optomotor response is a ...

Research

JoVE Journal

Behavior

Assessment of Sensorimotor Function in Mouse Models of Parkinson's Disease

Beurteilung der Sensomotorik in Maus-Modellen der Parkinson-Krankheit

Sensitive and  reliable behavioral outcome measures are essential to the evaluation of  potential therapeutic treatments in preclinical trials for many  ...

Forschung

Verhalten

The Crossmodal Congruency Task as a Means to Obtain an Objective Behavioral Measure in the Rubber Hand Illusion Paradigm

Die Kongruenz Crossmodale Aufgabe als ein Mittel zum Ziel Behavioral Messen in der Rubber Hand Illusion Paradigm erhalten

The rubber hand illusion (RHI) is a popular experimental paradigm. Participants view touch on an artificial rubber hand while the participants' own hidden ...

Irrelevant Stimuli and Action Control: Analyzing the Influence of Ignored Stimuli via the Distractor-Response Binding Paradigm

Irrelevante Reize und Aktionssteuerung: Analyse der Einfluss von Stimuli ignoriert über die Distraktor-Response-Paradigma-Bindung

Selection tasks in which simple stimuli (e.g. letters) are presented and a target stimulus has to be selected against one or more distractor stimuli are ...

A Procedure to Observe Context-induced Renewal of Pavlovian-conditioned Alcohol-seeking Behavior in Rats

Eine Vorgehensweise, um Context-induzierte Erneuerung der Pawlowschen Anlage Alkoholsucht bei Ratten Verhalten beobachten

Environmental contexts in which drugs of abuse are consumed can trigger craving, a subjective Pavlovian-conditioned response that can facilitate ...

The Knob Supination Task: A Semi-automated Method for Assessing Forelimb Function in Rats

Drehknopf Supination Aufgabe: Eine halbautomatische Methode für die Beurteilung der Funktion der Vordergliedmaße bei Ratten

Tasks that accurately measure dexterity in animal models are critical to understand hand function. Current rat behavioral tasks that measure dexterity ...

Simultaneous Recordings of Cortical Local Field Potentials and Electrocorticograms in Response to Nociceptive Laser Stimuli from Freely Moving Rats

Gleichzeitige Aufnahmen von kortikalen lokales Feld Potentialen und Electrocorticograms in Reaktion auf Reize der nozizeptiven Laser von frei beweglichen Ratten

Electrocortical responses, elicited by laser heat pulses that selectively activate nociceptive free nerve endings, are widely used in many animal and ...

Supramaximal Intensity Hypoxic Exercise and Vascular Function Assessment in Mice

Supramaximalen hypoxischer Intensität und Gefäßfunktion Bewertung bei Mäusen

Exercise training is an important strategy for maintaining health and preventing many chronic diseases. It is the first line of treatment recommended by ...

Investigating the Deployment of Visual Attention Before Accurate and Averaging Saccades via Eye Tracking and Assessment of Visual Sensitivity

Die Bereitstellung der visuellen Aufmerksamkeit vor genau und durchschnittlich Sakkaden über Eye-Tracking und Bewertung der visuelle Empfindlichkeit zu untersuchen

This experimental protocol was designed to investigate whether visual attention is obligatorily deployed at the endpoint of saccades. To this end, we ...

Integrating Visual Psychophysical Assays within a Y-Maze to Isolate the Role that Visual Features Play in Navigational Decisions

Integration visueller psychophysischer Assays in ein Y-Maze, um die Rolle zu isolieren, die visuelle Features bei Navigationsentscheidungen spielen

Collective animal behavior arises from individual motivations and social interactions that are critical for individual fitness. Fish have long inspired ...

Dynamic Digital Biomarkers of Motor and Cognitive Function in Parkinson's Disease

Dynamische digitale Biomarker der motorischen und kognitiven Funktion bei Parkinson

As Parkinson&#8217;s disease (PD) is a heterogeneous disorder, personalized medicine is truly required to optimize care. In their current form, standard ...