Name: tandem affinity purification of protein complexes from eukaryotic cells
Uploaded: 2017-01-26T14:00:00.000+00:00
Duration: 11 min 30 s
Description: Watch this Scientific Journal Video about Tandem Affinity Purification of Protein Complexes from Eukaryotic Cells at JoVE.com

Research reported in this publication was supported by the National Institute of Allergy and Infectious Diseases (NIAID) of the NIH under award number R01AI114362 and Welch Foundation grant I-1782 to Iv&#225;n D'Orso.

1. خلايا التصفيحات <ol style=";text-align:right;direction:rtl"><li style=";text-align:right;direction:rtl"> قبل يوم واحد ترنسفكأيشن، لوحة 3.5 × 10 6 خلايا HEK293T في 10 مل من Dulbecco لتعديل النسر متوسطة (DMEM) تستكمل مع 10٪ (ت / ت) مصل بقري جنيني (FBS) و 1٪ (ت / ت) البنسلين / الستربتوميسين (/ الأسهم مل 10،000 U) في صحن 100 ملم. لوحة 3-5 100 ملم أطباق في التجربة / حالة لضمان الانتعاش ما يكفي من البروتين. ملاحظة: عدد من لوحات لابد من تحديدها لكل تجربة / حالة، والتي سوف تعتمد على مستويات التعبير والذوبان في مجمع البروتين من الفائدة. بدلا من ذلك، إذا كانت هناك حاجة لتنقية نطاق أوسع، خطوط الخلايا يمكن تكييفها لتنمو في تعليق في قوارير الدوار 2، ولكن هذه الطريقة لا تعمل لتعداء عابر. </li></ol> 2. Transfecting خلايا أو التسبب خطوط الخلية مستقرة <ol style=";text-align:right;direction:rtl"><li style=";text-align:right;direction:rtl"> في اليوم التالي، والتحقق من الخلايا تحت المجهر. يجب أن تكون خلايا 70-80٪ متموجة قبل صناعة تجeding. </li><li style=";text-align:right;direction:rtl"> Transfect الخلايا مع خليط مجموع 7 ميكروغرام من البلازميد و 21 ميكرولتر من كاشف ترنسفكأيشن في صحن 100 ملم. خلايا Transfect مع ناقلات معربا عن GFP (الجدول 1) وجهاز تحكم عن كفاءة ترنسفكأيشن. ملاحظة: إذا باستخدام HEK293-T-REX أو خط الخلية مستقرة مشابه الحث على التعبير من اثنين أو أكثر تعقيدا مفارز ردا على الدوكسيسيكلين 14، 15، ومحفز يجب أن تضاف إلى الخلايا والمحتضنة لمدة 48 ساعة. وبالمثل، خط خلية مستقر الحث على التعبير عن GFP على إضافة محفز ستكون هناك حاجة أيضا لأغراض التحقق من الصحة. انتقل إلى الخطوة 2.7. </li><li style=";text-align:right;direction:rtl"> إعداد خليط ترنسفكأيشن في صحن 100 ملم. في أنبوب microcentrifuge 1.5 مل، مزيج 500 ميكرولتر من DMEM unsupplemented مع 7 ميكروغرام من إجمالي DNA البلازميد (المقابلة لاثنين أو أكثر من البلازميدات). في أنبوب microcentrifuge منفصل، مزيج 500 ميكرولتر من unsupplemented واي DMEMال 21 ميكرولتر من كاشف ترنسفكأيشن. كرر لكل رد فعل ترنسفكأيشن. </li><li style=";text-align:right;direction:rtl"> ماصة الحل ترنسفكأيشن الكاشف في حل DNA البلازميد (لا تخلط بين الحلول بالترتيب العكسي). مزيج من قبل pipetting 4 مرات على الأقل. </li><li style=";text-align:right;direction:rtl"> احتضان هذا الخليط في درجة حرارة الغرفة ل10-15 دقيقة، ولكن لم يعد من 15 دقيقة. </li><li style=";text-align:right;direction:rtl"> إمالة لوحة لإنشاء خزان سائل الإعلام وبعناية ماصة الخليط ترنسفكأيشن قطرة من الحكمة على الجانب الداخلي من لوحة من دون إزعاج الخلايا. إعادة الإناء لموقفها ثابت الأصلي ودوامة بلطف لتوزيع الخليط. </li><li style=";text-align:right;direction:rtl"> احتضان الخلايا عند 37 درجة مئوية في حاضنة الثقافة خلية ترطيب مع 5٪ CO 2 (ويشار إلى هذه الحالة فيما يلي باسم &quot;نسيج الثقافة الحاضنة&quot;). استبدال وسائل الإعلام 5 ساعة بعد ترنسفكأيشن (اختياري). </li></ol> 3. ترنسفكأيشن فحص أو الحث الكفاءة <ol style=";text-align:right;direction:rtl"><li style=";text-align:right;direction:rtl"> في 24 ساعة بعد ترنسفكأيشن، تصور الخلايا تحت انفلونزاالمجهر orescent للتحقق من كفاءة ترنسفكأيشن (أو تحريض السيطرة HEK293T-REX خط الخلية مستقرة التعبير عن GFP). احتضان لمدة 24 ساعة أخرى. </li></ol> 4. بكتيريا الانجذاب تنقية (بكتيريا ا ف ب) <ol style=";text-align:right;direction:rtl"><li style=";text-align:right;direction:rtl"> جمع الخلايا <ol style=";text-align:right;direction:rtl"><li style=";text-align:right;direction:rtl"> في 48 ساعة بعد ترنسفكأيشن، وإزالة وسائل الإعلام وإضافة 8 مل من المياه المالحة الفوسفات-1X الباردة (PBS). ماصة صعودا وهبوطا لفصل الخلايا من لوحة. </li><li style=";text-align:right;direction:rtl"> جمع ونقل تعليق الخلية في أنبوب 15 مل وتدور الخلايا في أسفل 800 x ج لمدة 4 دقائق على 4 درجات مئوية. </li><li style=";text-align:right;direction:rtl"> إزالة طاف برنامج تلفزيوني. كرر تدور أسفل (800 x ج لمدة 1 دقيقة في 4 درجة مئوية) للقضاء على أي برنامج تلفزيوني المتبقية. تخزين بيليه خلية في -80 درجة مئوية لاستخدامها في المستقبل أو اتبع الإجراء أدناه لمواصلة تنقية البروتين. </li></ol></li><li style=";text-align:right;direction:rtl"> الناشر الخلايا <ol style=";text-align:right;direction:rtl"><li style=";text-align:right;direction:rtl"> Resuspend والكريات الخلايا باستخدام 5 × حجم الخلية بيليه (~ 250 ميكرولتر لكل لوحة) من السلبي الاحتياطي تحلل(PLB: 20 ملي تريس، حمض الهيدروكلوريك 7.5 درجة الحموضة، 150 مم كلوريد الصوديوم، 1.5 ملي MgCl 2، 1 ملم DTT، مثبط البروتياز كوكتيل لوحي، 5٪ ت / الجلسرين الخامس، و 1.0٪ NP-40) ونقل تعليق خلية ل 1.5 مل أنبوب microcentrifuge. </li><li style=";text-align:right;direction:rtl"> لفترة وجيزة دوامة تعليق وnutate لمدة 30 دقيقة على 4 درجات مئوية. </li><li style=";text-align:right;direction:rtl"> تدور باستمرار تعليق خلية في 10000 x ج لمدة 10 دقيقة على 4 درجات مئوية. </li><li style=";text-align:right;direction:rtl"> نقل لست] القابلة للذوبان في أنبوب جديد microcentrifuge ل1.5 مل وتجاهل الكريات الخلية. وفر 10٪ من الحجم النهائي للالمحللة للذوبان باسم &quot;بكتيريا ا ف ب الإدخال&quot;. تخزينها في 4 درجات مئوية. </li></ol></li><li style=";text-align:right;direction:rtl"> توازنه حبات بكتيريا ملاحظة: الخرز استخدام بكتيريا للخطوة AP الأولى! سحبت مجمعات أسفل مع حبات بكتيريا استرداد أكبر بكثير من البروتين من تلك التي سحبت إلى أسفل مع حبات FLAG. <ol style=";text-align:right;direction:rtl"><li style=";text-align:right;direction:rtl"> إخراج (ن × 40 ميكرولتر) + ن ميكرولتر من 50٪ بكتيريا حبة الطين (ن = عدد العينات) وتدور باستمرار في 1500 x ج لمدة 2 دقيقة على 4 درجات مئوية. ملاحظة: استخدم على نطاق منصائح outhed إلى الخرز ماصة. </li><li style=";text-align:right;direction:rtl"> إزالة طاف وإضافة 500 ميكرولتر من PLB إلى الخرز. Nutate الخليط حبات لمدة 5 دقائق في 4 درجات مئوية. تدور باستمرار في 1500 x ج لمدة 2 دقيقة على 4 درجات مئوية. <ol style=";text-align:right;direction:rtl"><li style=";text-align:right;direction:rtl"> تكرار لما مجموعه 3 يغسل. resuspend والخرز في PLB إلى الحجم النهائي من ن × 40 ميكرولتر. </li></ol></li><li style=";text-align:right;direction:rtl"> إضافة 40 ميكرولتر من 50٪ بكتيريا حبة الطين لكل عينة الخلايا المحللة وnutate لمدة 2 ساعة في 4 درجات مئوية. </li></ol></li><li style=";text-align:right;direction:rtl"> بكتيريا AP <ol style=";text-align:right;direction:rtl"><li style=";text-align:right;direction:rtl"> تدور باستمرار الحل في 1500 x ج لمدة 2 دقيقة على 4 ج. </li><li style=";text-align:right;direction:rtl"> إزالة طاف ومخزن باسم &quot;بكتيريا AP التدفق من خلال (FT)&quot; في 4 درجات مئوية. </li><li style=";text-align:right;direction:rtl"> إضافة 500 ميكرولتر من بكتيريا AP الاحتياطي اغسل الأول (20 ملي تريس، حمض الهيدروكلوريك 7.5 درجة الحموضة، 250 مم كلوريد الصوديوم، 1.5 ملي MgCl 2، 1 ملم DTT، 5٪ الجلسرين و 0.2٪ NP-40) إلى الخرز. Nutate الخليط حبات لمدة 5 دقائق في 4 درجات مئوية، وأجهزة الطرد المركزي في 1500 x ج لمدة 2 دقيقة على 4 درجات مئوية. تجاهل طاف. <ol style=";text-align:right;direction:rtl"><li style=";text-align:right;direction:rtl"> تكرار لما مجموعه 4 يغسل. <br/&gt; ملاحظة: قبل غسل الرابع، ونقل الحل الخرز لأنبوب جديد microcentrifuge ل1.5 مل للحد من خلفية البروتين. هذه الخطوة ضرورية. </li></ol></li><li style=";text-align:right;direction:rtl"> إضافة 500 ميكرولتر غسل العازلة الثاني (100 ملي تريس، حمض الهيدروكلوريك 8.0 درجة الحموضة، 150 مم كلوريد الصوديوم، و 1 ملي EDTA) وتتوازن حبات من قلب الأنابيب. تدور باستمرار في 1500 x ج لمدة 2 دقيقة على 4 درجات مئوية، وتجاهل طاف. </li><li style=";text-align:right;direction:rtl"> أزل البروتين في المصالح مع 50 ميكرولتر من بكتيريا شطف العازلة (100 ملي تريس، حمض الهيدروكلوريك 8.0 درجة الحموضة، 150 مم كلوريد الصوديوم، 1 ملم EDTA، و 2.5 ملي Desthiobiotin). دوامة في 800 دورة في الدقيقة لمدة 15 دقيقة على 4 درجات مئوية. </li><li style=";text-align:right;direction:rtl"> تدور باستمرار حبات في 1500 x ج لمدة 1 دقيقة على 4 درجات مئوية. جمع طاف. هذا جزء يتوافق مع عينة &quot;بكتيريا AP شطف&quot;. </li><li style=";text-align:right;direction:rtl"> حفظ جزء حبات عند 4 درجة مئوية لمدة شطف الثاني، والتي يمكن أن تسفر عن ما يصل الى نصف كمية البروتين التي تم الحصول عليها مع شطف الأول. قسامة 10٪ من بكتيريا AP شطف لتلطيخ الفضة و / أو النشاف الغربي16. </li></ol></li><li style=";text-align:right;direction:rtl"> توازنه حبات FLAG <ol style=";text-align:right;direction:rtl"><li style=";text-align:right;direction:rtl"> إخراج (NX 16 ميكرولتر) + ن ميكرولتر من FLAG الخرز حل (ن = عدد العينات) وتدور باستمرار في 1500 x ج لمدة 2 دقيقة على 4 درجات مئوية. ملاحظة: استخدام نصائح واسعة الفم إلى الخرز ماصة. </li><li style=";text-align:right;direction:rtl"> إزالة طاف وإضافة 500 ميكرولتر من غسل العازلة FLAG (100 ملي تريس، حمض الهيدروكلوريك 8.0 درجة الحموضة، 150 مم كلوريد الصوديوم، 1 ملم EDTA، و 0.1٪ NP-40) إلى الخرز. تدور باستمرار في 1500 x ج لمدة 2 دقيقة على 4 درجات مئوية. تكرار لما مجموعه 3 يغسل. </li><li style=";text-align:right;direction:rtl"> resuspend والخرز في غسل العازلة FLAG إلى الحجم النهائي من NX 16 ميكرولتر. </li><li style=";text-align:right;direction:rtl"> إضافة 16 ميكرولتر من الطين FLAG حبة لشطف بكتيريا AP المتبقية وبين عشية وضحاها nutate في 4 درجات مئوية. </li></ol></li></ol> 5. FLAG IP <ol style=";text-align:right;direction:rtl"><li style=";text-align:right;direction:rtl"> تدور باستمرار تعليق الخرز FLAG في 1500 x ج لمدة 2 دقيقة على 4 درجات مئوية. حفظ طاف ومخزن باسم &quot;FLAG IP تدفق من خلال&quot; (FT) في 4 درجات مئوية. </li><li style=";text-align:right;direction:rtl"> إضافة 50081؛ ل من غسل العازلة FLAG إلى الحل. Nutate لمدة 5 دقائق في 4 درجات مئوية، وأجهزة الطرد المركزي في 1500 x ج لمدة 2 دقيقة على 4 درجات مئوية. تكرار لما مجموعه 4 يغسل وإزالة طاف بعد كل غسل. ملاحظة: قبل غسل الرابع، ونقل حل الخرز البروتين لأنبوب جديد microcentrifuge ل1.5 مل للحد من الخلفية. هذه الخطوة ضرورية. </li><li style=";text-align:right;direction:rtl"> إزالة طاف من زيادة ونقصان النهائي وإضافة 30 ميكرولتر من غسل العازلة FLAG تحتوي على 200 نانوغرام / ميكرولتر من الببتيد FLAG في الخرز. دوامة في 800 دورة في الدقيقة لمدة 2 ساعة في 4 درجات مئوية. </li><li style=";text-align:right;direction:rtl"> تدور باستمرار تعليق في 1500 x ج لمدة 2 دقيقة على 4 درجات مئوية. حصاد طاف وتخزينها في 4 درجات مئوية باسم &quot;FLAG IP شطف.&quot; ملاحظة: يمكن التأكد من العينات شطف بواسطة وصمة عار الفضة و / أو لطخة غربية باستخدام البروتوكولات القياسية 16، ونحن على استعداد لمزيد من المقايسات البروتين. عند إعداد وصمة عار الغربية، تشغيل جميع العينات التالية: (1) بكتيريا ا ف ب الإدخال، (2) بكتيريا ا ف ب FT، (3) بكتيريا AP Elutiعلى، (4) FLAG IP FT، و (5) FLAG IP شطف. فإن حجم تحميل يجب أن يحدد لكل تجربة. جميع العينات التي تم جمعها والخرز يمكن تخزينها في 4 درجة مئوية لمدة التخزين على المدى القصير وفي -80 درجة مئوية لمدة التخزين على المدى الطويل. ويمكن تحليل عينات التونسية التي كتبها الطيف الكتلي للتحقق من هوية من مكوناتها، وتحديد رواية التعديلات بعد متعدية (PTMs)، و / أو لاكتشاف أي تفاعل البروتين الرواية مع مجمع النقي 2 و 17. لهذا الغرض، بعد تشغيل هلام coomassie أو الفضة وصمة عار، والعصابات يمكن رفعه من الجل باستخدام مشرط نظيفة. العديد من الاستعراضات الممتازة التي مناقشة أساليب مطياف الكتلة نشرت سابقا 18 و 19. </li></ol>

<ol>
	<li>Sharan, R., Ulitsky, I., Shamir, R. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Network-based+prediction+of+protein+function.">Network-based prediction of protein function.</a> Mol Syst Biol. 3, 88-99 (2007).</li><li>Jager, S., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Global+landscape+of+HIV-human+protein+complexes.">Global landscape of HIV-human protein complexes.</a> Nature. 481, 365-370 (2012).</li><li>Fields, S., Song, O. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=A+novel+genetic+system+to+detect+protein-protein+interactions.">A novel genetic system to detect protein-protein interactions.</a> Nature. 340, 245-246 (1989).</li><li>Luo, Y., Batalao, A., Zhou, H., Zhu, L. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Mammalian+two-hybrid+system:+a+complementary+approach+to+the+yeast+two-hybrid+system.">Mammalian two-hybrid system: a complementary approach to the yeast two-hybrid system.</a> Biotechniques. 22, 350-352 (1997).</li><li>Lee, C. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Coimmunoprecipitation+assay.">Coimmunoprecipitation assay.</a> Methods Mol Biol. 362, 401-406 (2007).</li><li>Puig, O., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+tandem+affinity+purification+(TAP)+method:+a+general+procedure+of+protein+complex+purification.">The tandem affinity purification (TAP) method: a general procedure of protein complex purification.</a> Methods. 24, 218-229 (2001).</li><li>Jager, S., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Purification+and+characterization+of+HIV-human+protein+complexes.">Purification and characterization of HIV-human protein complexes.</a> Methods. 53, 13-19 (2011).</li><li>Price, D. H. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=P-TEFb,+a+cyclin-dependent+kinase+controlling+elongation+by+RNA+polymerase+II.">P-TEFb, a cyclin-dependent kinase controlling elongation by RNA polymerase II.</a> Mol Cell Biol. 20, 2629-2634 (2000).</li><li>Peterlin, B. M., Price, D. H. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Controlling+the+elongation+phase+of+transcription+with+P-TEFb.">Controlling the elongation phase of transcription with P-TEFb.</a> Mol Cell. 23, 297-305 (2006).</li><li>McNamara, R. P., McCann, J. L., Gudipaty, S. A., D'Orso, I. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Transcription+factors+mediate+the+enzymatic+disassembly+of+promoter-bound+7SK+snRNP+to+locally+recruit+P-TEFb+for+transcription+elongation.">Transcription factors mediate the enzymatic disassembly of promoter-bound 7SK snRNP to locally recruit P-TEFb for transcription elongation.</a> Cell Rep. 5, 1256-1268 (2013).</li><li>Adelman, K., Lis, J. T. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Promoter-proximal+pausing+of+RNA+polymerase+II:+emerging+roles+in+metazoans.">Promoter-proximal pausing of RNA polymerase II: emerging roles in metazoans.</a> Nat Rev Genet. 13, 720-731 (2012).</li><li>D'Orso, I. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=7SKiing+on+chromatin:+move+globally,+act+locally.">7SKiing on chromatin: move globally, act locally.</a> RNA Biol. 13, 545-553 (2016).</li><li>McNamara, R. P., Bacon, C. W., D'Orso, I. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Transcription+Elongation+Control+by+the+7SK+snRNP+Complex:+Releasing+the+Pause.">Transcription Elongation Control by the 7SK snRNP Complex: Releasing the Pause.</a> Cell Cycle. 15, 2115-2123 (2016).</li><li>Yao, F., Svensjo, T., Winkler, T., Lu, M., Eriksson, C., Eriksson, E. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Tetracycline+repressor,+tetR,+rather+than+the+tetR-mammalian+cell+transcription+factor+fusion+derivatives,+regulates+inducible+gene+expression+in+mammalian+cells.">Tetracycline repressor, tetR, rather than the tetR-mammalian cell transcription factor fusion derivatives, regulates inducible gene expression in mammalian cells.</a> Hum Gene Ther. 9, 1939-1950 (1998).</li><li>McNamara, R. P., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=KAP1+Recruitment+of+the+7SK+snRNP+Complex+to+Promoters+Enables+Transcription+Elongation+by+RNA+Polymerase+II.">KAP1 Recruitment of the 7SK snRNP Complex to Promoters Enables Transcription Elongation by RNA Polymerase II.</a> Mol Cell. 61, 39-53 (2016).</li><li>Ausubel, F. M., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=.">.</a> Current Protocols in Molecular Biology. , (1994).</li><li>Trudgian, D. C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Comparative+evaluation+of+label-free+SINQ+normalized+spectral+index+quantitation+in+the+central+proteomics+facilities+pipeline.">Comparative evaluation of label-free SINQ normalized spectral index quantitation in the central proteomics facilities pipeline.</a> Proteomics. 11, 2790-2797 (2011).</li><li>Choudhary, C., Mann, M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Decoding+signalling+networks+by+mass+spectrometry-based+proteomics.">Decoding signalling networks by mass spectrometry-based proteomics.</a> Nat Rev Mol Cell Biol. 11, 427-439 (2010).</li><li>Bensimon, A., Heck, A. J., Aebersold, R. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Mass+spectrometry-based+proteomics+and+network+biology.">Mass spectrometry-based proteomics and network biology.</a> Annu Rev Biochem. 81, 379-405 (2012).</li><li>Rogers, S., Wells, R., Rechsteiner, M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Amino+acid+sequences+common+to+rapidly+degraded+proteins:+the+PEST+hypothesis.">Amino acid sequences common to rapidly degraded proteins: the PEST hypothesis.</a> Science. 234, 364-368 (1986).</li></ol>

The authors have nothing to disclose.

بروتوكول صفها هنا للتعبير عن وعزل بروتين المجمعات من الخلايا حقيقية النواة لا يقتصر على توصيف البيوكيميائية مثل هذه التجمعات الجزيئية، ولكن يمكن أيضا أن تستخدم لتحديد interactors الجديدة والتعديلات بعد متعدية التي يمكن أن تنظم وظيفتها. لا يقتصر استخدام علامات التقارب إلى ما ورد في هذا البروتوكول. ولكن تجربتنا تشير إلى أن استخدام بكتيريا كخطوة AP الأولى تعزز بشكل كبير من العائد من مجمع البروتين البروتين النهائي. كلا الخطوات الملزمة وشطف من وإلى حبات بكتيريا هي فعالة للغاية مقارنة مع غيرها من العلامات حاتمة (على سبيل المثال، FLAG). وبالإضافة إلى ذلك، من الناحية النظرية، يمكن أن تطبق التونسية للبروتينات أو المجالات الأخرى مع بعض التحسينات الطفيفة، مثل ظروف عازلة، وعدد من لوحات في التجربة (لأنظمة التعبير عابرة ومستقرة على حد سواء)، الخ. وعلاوة على ذلك، يمكن أيضا أن تكون طريقة TAP ر التطبيقيةس خطوط الخلايا الأخرى إذا تتطلب مجمعات البروتين محددة نظام خاص لوظيفتها أو تفاعلها مع عوامل فريدة من نوعها. لتسهيل استكشاف الأخطاء وإصلاحها، فمن المستحسن جدا أن المدخلات وFT عينات كل من يتم حفظ (الجدول 2). عندما العصابات البروتين المتوقع لا يمكن تصور في شطف، وعينات FT يمكن استخدامها لاستكشاف التجربة وتحديد ما إذا كان أو لم يكن عينة قد ملزمة لو / أو مزال الخروج من الخرز. وكالة الأنباء التونسية الناجحة هي التي تعتمد بشكل صارم على مستويات عالية من بروتين تعبير والانتعاش. وبالتالي فإن الباحثين لتحسين كمية بدءا المواد على أساس كل حالة على حدة. إذا تم استخدام ترنسفكأيشن عابرة للتعبير عن مكونات البروتين، وينبغي أن تكون كفاءة ترنسفكأيشن لا يقل عن 70٪ قبل الشروع في الخطوة الثانية من برنامج المشورة التقنية. الطريقة التونسية المتبادل (التي يتم تبديل الحواتم بين الطعم اثنين) وعادة ما يساعد في تحديد استراتيجية تجريبيةوينبغي أن تستخدم لتحقيق أفضل نقاء والعائد. مرة أخرى، وهذا سيكون لديك ليتم التحقيق على أساس كل حالة على حدة. الأهم من ذلك، أداء TAP متبادلة يؤكد أيضا أن مؤشر أسعار المنتجين مستقلة للعلامة تقارب المستخدمة. بعض جوانب الطريقة التونسية قدمت لها قيود في هذه الوثيقة. على سبيل المثال، overexpressing وFLAG- والبروتينات الموسومة بكتيريا يمكن أن تولد الأعمال الفنية للبروتين أعرب ectopically نفسها أو interactors بهم. قد تؤثر على علامات حاتمة مختلف المستويات تعبير البروتين، التشكل البروتين، و / أو توطين التحت خلوية. وبالاضافة الى خط الخلية والكفاءة ترنسفكأيشن الحد، وحجم المجمعات ليكون منقى قد يكون مشكلة. هذه الطريقة التونسية يعمل بشكل جيد للبروتين المجمعات متعددة فرعية. من تجربتنا، وأربعة عناصر يمكن الكشف عنها بواسطة وصمة عار الفضة (لا تظهر البيانات). ومع ذلك، عند استخدام مكونات الموسومة اثنين، قد لا يكون interactors أخرى شارك في تنقية عند مستويات متكافئة متطابقة. وبالتالي،لهذا الهدف المحدد، وينصح استخدام خطوط الخلايا الذي يسبب انخفاض مستويات التعبير عن مكونات معقدة. أن الحد الآخر هو قوة مؤشر أسعار المنتجين. إذا كانت التفاعلات ليست مستقرة بما فيه الكفاية، يمكن أن تفقد بعض المكونات أثناء خطوات تنقية (لا سيما في خطوة IP FLAG النهائية). وقد وصفت طريقة التونسية سابقا وتم اختبار عدة علامات حاتمة مختلفة، التحقق من صحة، ومقارنة 6. ومع ذلك، فإن الطريقة التونسية في هذه المقالة هو الرواية، ويقدم استراتيجية سهلة وفعالة وقوية، وبديلة لدراسة مثبطات مضخة البروتون، والتجمع معقدة، والاستدلال على تكوين شبكة البروتين وظيفة. بالمقارنة مع الطرق التونسية السابقة، تسمح هذه الاستراتيجية التونسية بكتيريا-FLAG لتنقية السريع المجمعات لمزيد من التوصيف دون علم مسبق معقدة التركيب، والنشاط، أو وظيفة. ودون الحاجة إلى انشقاق الأنزيم البروتيني (على سبيل المثال، TEV) لشطف البروتين (WHالتراث الثقافي غير المادي يمكن أن تقلل بشكل كبير العائد البروتين). ونظرا لزيادة الانتعاش بروتين معقد، وطريقة TAP بكتيريا-FLAG يسمح أيضا لتحديد القوي من البروتينات التي ترتبط في مجمع البروتين من الفائدة في الخلايا من خلال تحليل جنبا إلى جنب قياس الطيف الكتلي 10، 15. وفي وقت لاحق، وأساليب أخرى، مثل الفحص المجهري متحد البؤر، اللوني حجم الإقصاء، والمقايسات شارك في الملكية الفكرية، ويمكن أيضا أن تستخدم للتحقق من صحة مثبطات مضخة البروتون. وأخيرا، فإننا نقترح أن صيغة بديلة للبروتوكول TAP يمكن تكييفها لتنقية ودراسة تجميع البروتين المجمعات الحمض النووي الريبي منفصلة، ​​الأمر الذي سيساعد بشكل كبير الباحثين في مجال علم الأحياء الحمض النووي الريبي. وباختصار، فإننا نقدم وسيلة لتنقية وتوصيف مثبطات مضخة البروتون في خطوط خلايا الثدييات. نقترح أن هذا الأسلوب يضع الأساس لتوصيف المستقبل والتحليل الوظيفي للعديد من المجمعات البروتين الرواية.

<html> تفاعلات البروتين البروتين (مثبطات مضخة البروتون) هي الحاسمة لتنظيم دقيق من العمليات البيولوجية 1، وإجراء المزيد من الدراسات حول هذه مثبطات مضخة البروتون يمكن أن تبلغ عن وظيفتها 2. وقد وضعت عدة نهج لدراسة وتوصيف مثبطات مضخة البروتون وكذلك لدي نوفو تحديد مكونات البروتين التنظيمية الجديدة. في عام 1989، ذكرت ستانلي فيلدز وزملاؤه الخميرة اثنين الهجين (Y2H) فحص 3. يسمح هذا النهج لتحديد متحيز وشامل للinteractors (يفترس) لبروتين محددة من الفائدة (الطعم) في خميرة الخباز. وبالإضافة إلى فائدة ملحوظة من أجل اكتشاف مثبطات مضخة البروتون، وفحص Y2H يمكن استخدامها لوصف أزواج البروتين في خلايا الخميرة، وتحديد مجالات التفاعل الحد الأدنى، وتحديد الطفرات التي إلغاء مثل هذه التفاعلات. عن طريق تعديل فحص Y2H، مثبطات مضخة البروتون يمكن أيضا أن تدرس في خلايا الثديياتالطبقة = &quot;XREF&quot;&gt; 4. ويمكن أيضا أن الاختلافات في فحص Y2H (على سبيل المثال، نظام الخميرة ثلاثة الهجين) يتم تطبيقها على دراسة البروتين RNA والتفاعلات يجند العضوية-بروتين صغير في الخلايا. أداة أخرى تستخدم عادة لدراسة مثبطات مضخة البروتون في نظام مثلي هي شارك في مناعي (شارك في IP) فحص 5. باستخدام أجسام مضادة لبروتين immunoprecipitate من الفائدة، وفحص المشارك IP يسمح للباحثين لمراقبة مثبطات مضخة البروتون في الخلايا للظروف البيئية المختلفة والحالات التجريبية. استخدام البروتينات الموسومة حاتمة (على سبيل المثال، FLAG، Myc على، بكتيريا، وHA، من بين أمور أخرى) في تنقية تقارب (ا ف ب) طرق سهلت عزل البروتينات من خليط من البروتين المعقدة لعدة فحوصات المصب، بما في ذلك وصمة عار الغربية، وصمة عار الفضة ، وتحليل الأنزيمي. ومع ذلك، فإن أيا من هذه الطرق السابقة يمكن عزل كميات كبيرة من البروتين المجمعات لمزيد من التوصيف بما في ذلك في المختبر لssays، اكتشاف مفارز التنظيمية التي الطيف الكتلي، وتحديد التعديلات بعد متعدية. ويطلق نسخة محسنة من طريقة AP جنبا إلى جنب AP (وات)، وهي تقنية تنقية لدراسة مثبطات مضخة البروتون عن طريق إنشاء بروتين الانصهار مع اثنين من الحواتم التي يتم تنقيته من خلال اثنين من نقاط وصول لاحقة 6 و 7. في هذه المقالة، نقدم الاختلاف في طريقة التونسية للمجمعات البروتين تنقية الذي يتم وضع علامة على وحدتين فرعيتين مع الحواتم مختلفة ثم تنقيته من خلال اثنين من نقاط وصول متسلسلة (بكتيريا AP تليها FLAG IP). علينا أولا تقديم لمحة أضيق الحدود من TAP (الشكل 1)، ثم وصفا مفصلا لجميع الخطوات التجريبية (الشكل 2)، بحيث يمكن للباحثين تطبيقها على بروتين معقد اهتمامهم. للتدليل على تطبيق هذه الطريقة التونسية، اخترنا جيدا اتسم السيكلين-معلمين المعقدة (ويشار إلى PTكيناز EFB)، التي تتألف من السيكلين T1 فرعية التنظيمية (CycT1) وكيناز (CDK9)، ويشارك في تنظيم النسخ التي كتبها RNA بوليميريز الثاني (بول الثاني) 8 و 9 و 10. ف TEFb phosphorylates المجال سي محطة للبول الثاني وما يرتبط بها من عوامل لها استطالة السلبية، والذي يخفف التوقف النسخي في المروج، وبالتالي يسهل النسخ استطالة 11 و 12 و 13. مع هذا التفاعل المعروف في الاعتبار، بكتيريا الموسومة CycT1 وكانت CDK9 الموسومة FLAG خلال أعرب في الخلايا HEK293T. تم إجراء التجربة التونسية متبادلة مع CDK9 الموسومة بكتيريا والموسومة FLAG CycT1 لمزيد من التحقق من أن التفاعل البروتين مستقلة عن الحواتم المستخدمة. وقد تم جمع الخلايا و lysed 48 ساعة بعد ترنسفكأيشن. تمت تنقية المحللة للذوبان التي كتبها TAP (بكتيريا AP تليها FLAGIP). وقد تم تحليل المدخلات وتنقية البروتينات لطخة الغربية وصمة عار الفضة (الشكل 3).

<table><tbody><tr><td>Dulbecco&#039;s Modified Eagle Medium (DMEM)</td><td>GE Healthcare Life Sciences/Hyclone</td><td>SH3002.2FS</td><td></td></tr><tr><td>Fetal bovine serum</td><td>GE Healthcare Life Sciences/Hyclone</td><td>SH30071</td><td></td></tr><tr><td>Penicillin/Streptomycin</td><td>MP Biomedicals</td><td>MP091670049</td><td></td></tr><tr><td>PolyJet</td><td>SignaGen Laboratories</td><td>SL100688</td><td></td></tr><tr><td>Protease inhibitor cocktail&amp;nbsp;</td><td>Roche&amp;nbsp;</td><td>11836153001</td><td></td></tr><tr><td>STREP-Tactin Superflow</td><td>IBA Lifesciences</td><td>2-1208-010</td><td></td></tr><tr><td>STREP-tag elution buffer</td><td>IBA Lifesciences</td><td>2-1000-025</td><td></td></tr><tr><td>EZview Red ANTI-FLAG M2 Affinity Gel</td><td>Sigma-Aldrich</td><td>F2426</td><td></td></tr><tr><td>Corning 100 mm &amp;times; 20 mm style dish cell culture treated nonpyrogenic polystyrene 20/sleeve</td><td>Corning&amp;nbsp;</td><td>430167</td><td></td></tr><tr><td>Protein Lo-Bind Eppendorf</td><td>Eppendorf</td><td>022431081</td><td></td></tr><tr><td>Digital Vortex Mixer</td><td>Fisher Scientific&amp;nbsp;</td><td>02-215-370</td><td></td></tr><tr><td>48 hole micro tube foam rack</td><td>Fisher Scientific</td><td>02-215-386</td><td></td></tr><tr><td>Labquake shaker rotisserie&amp;nbsp;</td><td>Thermo&amp;nbsp;</td><td>415110</td><td></td></tr></tbody></table>

tandem affinity purification of protein complexes from eukaryotic cells

تنقية نشط البروتين البروتين والمجمعات حمض البروتين النووي هو أمر حاسم لتوصيف الأنشطة الإنزيمية ودي نوفو تحديد الوحدات الفرعية الجديدة والتعديلات بعد متعدية. أنظمة بكتيرية تسمح للتعبير وتنقيتها من مجموعة واسعة من البروتينية واحدة والمجمعات البروتين. ومع ذلك، فإن هذا النظام لا يمكن تنقية مفارز البروتين التي تحتوي على التعديلات بعد متعدية (على سبيل المثال، الفسفرة وأستلة)، وتحديد مفارز التنظيمية الجديدة التي تكون موجودة فقط / أعرب في النظام حقيقية النواة. هنا، ونحن نقدم وصفا مفصلا للرواية، وقوية، وطريقة فعالة لتنقية جنبا إلى جنب تقارب (وات) باستخدام STREP- والبروتينات الموسومة FLAG الذي يسهل عملية تنقية البروتين المجمعات مع عابر أو مستقر أعرب البروتينات الموسومة حاتمة من الخلايا حقيقية النواة. هذا البروتوكول يمكن تطبيقها على تميز بروتعين الوظائف المعقدة، لاكتشاف التعديلات بعد متعدية على مفارز معقدة، وتحديد مكونات معقدة تنظيمية جديدة من خلال قياس الطيف الكتلي. والجدير بالذكر، يمكن تطبيق هذه الطريقة التونسية لدراسة المجمعات البروتين يتكون من مكونات حقيقية النواة أو المسببة للأمراض (الفيروسية والبكتيرية)، وبالتالي مما أسفر عن مجموعة واسعة من الفرص التجريبية المصب. نقترح أن الباحثين العاملين مع المجمعات البروتين يمكن الاستفادة من هذا النهج في العديد من الطرق المختلفة.

في هذه المقالة، ونحن لشرح تطبيق هذه الطريقة التونسية للتميز جيدا CycT1-CDK9 معقدة (المعروف أيضا باسم P-TEFb كيناز). البلازميدات ترميز السيكلين T1-بكتيريا (CycT1: S) وCDK9-FLAG (CDK9: F)، أو CDK9-بكتيريا (CDK9: S) والسيكلين T1-FLAG (CycT1: F) (الجدول 1)، و transfected في الخلايا HEK293T . وتضمنت الضوابط السلبية تعداء مع ناقلات فارغة وCDK9: F أو CycT1: البلازميدات F (أرقام 3A وباء، على التوالي). وأعرب عن البروتينات لمدة 48 ساعة قبل جمع الخلايا. تم استخدام لوحات متعددة من الخلايا في التجربة (استخدمت خمس لوحات لكل عينة للبيانات الواردة في الشكل 3) لزيادة إنتاج بروتين والانتعاش. بعد هي lysed الخلايا في أنابيب microcentrifuge الفردية، تم الجمع بين الخلية لست] من نفس العينة إلى microcentrif واحدأنبوب أويغه قبل إضافة حبات بكتيريا. الجمع بين عينات البروتين مع جزء واحد من الخرز يزيد من تركيز البروتين النهائي، التي يمكن أن تحسن الانتعاش بروتين من البروتينات التي يصعب التعبير. بعد شطف الأولي، وشطف الثاني يمكن القيام به من أجل زيادة مجموع المدخلات البروتين لIP FLAG. من المهم أن توفر المدخلات لكل خطوة تنقية قبل إضافة حبات لاستكشاف الأخطاء وإصلاحها في المستقبل (الجدول 2)، إذا لزم الأمر. تظهر البيانات في الشكل 3A نتائج الطريقة التونسية لCycT1: S وCDK9: F وتحليلها بواسطة لطخة غربية. CDK9: F المشارك مزال مع CycT1: S من الخرز بكتيريا، ولكن ليس في وكالة اسوشييتد برس تحكم سلبي تفتقر CycT1: S، مشيرا إلى أن CDK9: F وCycT1: S تشكيل مجمع البروتين البروتين. متوقعا، تم الكشف عن كل من البروتينات في شطف FLAG، التي أكدت أيضا على تشكيل تعقيدا. ويبين الشكل 3B للدورة الفتشوبLTS من طريقة المتبادل TAP، حيث تبادلت العلامات حاتمة من اثنين من البروتينات (CDK9: S وCycT1: F)، وتحليلها بواسطة لطخة غربية. أرقام 3C و 3D تظهر نتائج برنامج المشورة التقنية والمساعدة التقنية المتبادلة تحليلها من قبل تلطيخ الفضة، على التوالي. أظهر الرقم 3C 2 لين أن CDK9: F-مزال التعاون مع CycT1: S الخروج من الخرز بكتيريا، ولكن ليس من سيطرة ا ف ب (حارة 1)، مما يدل على أن CDK9: F وCycT1: S تشكيل مجمع البروتين البروتين. في شطف FLAG لاحق، كما هو مبين في حارة 4، CycT1: S المشارك مزال مع CDK9: F الخروج من الخرز FLAG. وبالمثل، أظهر الشكل 3D التي CycT1:-مزال شارك F مع CDK9: S الخروج من الخرز بكتيريا، ولكن ليس من AP السيطرة، وأن مجمع البروتين البروتين عثر بفعالية بعد خطوة IP FLAG الثانية. كلا أكدت البقع الغربية والبقع الفضية أن البروتوكول وات تعمل بكفاءة عالية لpurificatio<html> ن، والعزلة، وتوصيف مجمع البروتين من الفائدة. <img alt="شكل 1" src="/files/ftp_upload/55236/55236fig1.jpg" /> الشكل 1: نظرة عامة على استراتيجية TAP تنقية. مخطط بسيط واصفا خطوات التونسية. البلازميدات ترميز البروتين في المصالح مع إما بكتيريا أو FLAG العلامة حاتمة هي شارك في transfected في خلايا الثدييات. بعد 48 ساعة الاستقراء، ويتم جمع الخلايا و lysed. يتم تحميل المحللة الخلية القابلة للذوبان التي تحتوي على البروتين من الفائدة جنبا إلى جنب مع غيرها من البروتينات على حبات بكتيريا للبكتيريا AP. ثم يتم مزال البروتينات التي تحتوي على أي علامة بكتيريا أو منضمة إلى بروتين بكتيريا الموسومة تعلق على الخرز. وبعد ذلك تضاف حبات FLAG في شطف بكتيريا. ثم يتم مزال البروتينات التي تحتوي على أي علامة FLAG أو لا بد أن البروتين-FLAG الموسومة تعلق على الخرز. يمكن تحليلها Elutions بالطرق المشار إليها.طالبان الباكستانية: //ecsource.jove.com/files/ftp_upload/55236/55236fig1large.jpg &quot;الهدف =&quot; _ فارغة &quot;&gt; الرجاء انقر هنا لعرض نسخة أكبر من هذا الرقم. <img alt="الشكل 2" src="/files/ftp_upload/55236/55236fig2.jpg" /> الشكل 2: التمثيل التخطيطي للاستراتيجية التونسية. بروتوكول مفصل لبرنامج المساعدة التقنية. انظر النص لمزيد من التفاصيل. <a href="http://ecsource.jove.com/files/ftp_upload/55236/55236fig2large.jpg" target="_blank">الرجاء انقر هنا لعرض نسخة أكبر من هذا الرقم.</a> <img alt="الشكل (3)" src="/files/ftp_upload/55236/55236fig3.jpg" /> الرقم 3: مثال من الخطوة بخطوة تحليل تنقية التونسية. (أ) تحليل لطخة غربية من TAP (CycT1: S وCDK9: F). (ب) تحليل لطخة غربية من TAP متبادلة (CDK9: S وCycT1: F). جيئة وذهابا<html> تم تحميل م 1 مل من الخلايا المحللة كله، 5 ميكرولتر (0.2٪) باسم &quot;بكتيريا ا ف ب الإدخال&quot;. تم إضافة 975 ميكرولتر من الخلية المحللة كله المتبقية إلى حبات بكتيريا للبكتيريا AP و 100 ميكرولتر من &quot;بكتيريا AP شطف&quot; تم جمعها. من هذا، كان 5 ميكرولتر (2٪) تحميل. تم إضافة 80 ميكرولتر من &quot;بكتيريا AP شطف&quot; لحبات FLAG للملكية الفكرية FLAG و 30 ميكرولتر من &quot;FLAG IP شطف&quot; تم جمعها. من 30 ميكرولتر من &quot;FLAG IP شطف&quot;، تم تحميل 7 ميكرولتر (23.3٪). (ج) تحليل وصمة عار فضي للTAP (CycT1: S وCDK9: F). تحليل (D) الفضة صمة TAP متبادلة (CDK9: S وCycT1: F). تم تحميل 5 ميكرولتر (2٪) من &quot;بكتيريا AP شطف&quot; و 7 ميكرولتر (23.3٪) من &quot;FLAG IP شطف&quot;. وتشير العلامات النجمية الشوائب شارك في مزال. <a href="http://ecsource.jove.com/files/ftp_upload/55236/55236fig3large.jpg" target="_blank">الرجاء انقر هنا لعرض نسخة أكبر من هذا الرقم.</a> <table fo:ke</html style=";text-align:right;direction:rtl">EP-together.within الصفحات = &quot;1&quot; FO: المحافظة على مع next.within صفحة = &quot;دائما&quot;&gt; <tbody><tr><td> بروتين </td><td> المخلفات </td><td> قوه موجهة </td><td> بطاقة </td><td> مواقع الاستنساخ </td><td> مرجع </td></tr><tr><td> CycT1 </td><td> 1-708 </td><td> pcDNA / 4TO </td><td> بكتيريا </td><td> HindIII - EcoRI </td><td> ماكنمارا وآخرون. 2013 10 </td></tr><tr><td> CycT1 </td><td> 1-708 </td><td> pcDNA / 4TO </td><td> FLAG </td><td> HindIII - EcoRI </td><td> هذا المقال </td></tr><tr><td> CDK9 </td><td> 1-372 </td><td> pcDNA / 4TO </td><td> بكتيريا </td><td> HindIII - XhoI </td><td> هذا المقال </td></tr><tr><td> CDK9 </td><td> 1-372 </td><td> pcDNA / 4TO </td><td> FLاي جي </td><td> HindIII - XhoI </td><td> ماكنمارا وآخرون، 2013 10 </td></tr><tr><td> GFP </td><td> 1-238 </td><td> pcDNA / 4TO </td><td> بكتيريا-FLAG </td><td> BamHI - XhoI </td><td> هذا المقال </td></tr></tbody></table> الجدول 1: البلازميدات المستخدمة في هذه الدراسة. تم ligated CycT1 وCDK9 في pcDNA / 4TO-بكتيريا وناقلات البلازميد pcDNA / 4TO-FLAG. تحولت هذه التركيبات في الخلايا المختصة DH5α ومطلي على لوحات LB-الأمبيسلين. وقد تم اختيار المستعمرات، نمت، وفحص. بنجاح وتم التحقق من الحيوانات المستنسخة ligated التي كتبها سانجر تسلسل والجمع بين الهضم تقييد والاغاروز الكهربائي للهلام. لCycT1 استخدمنا نسخة مختصرة (1-708) بدلا من كامل طول (1-726) لأن 18 بقايا مشاركة تحتوي على تسلسل الآفات (سلسلة ببتيد غنيةالبرولين، وحمض الجلوتاميك، سيرين، وثريونين)، الذي يعمل بمثابة إشارة الببتيد لتدهور البروتين 20. كان CDK9 كامل طول. تسلسل العلامة جنبا إلى جنب بكتيريا كما يلي: GGGGWSHPQFEKGGGSGGGSGGGSWSHPQFEK. تسلسل العلامة جنبا إلى جنب العلم هو كما يلي: GGGGDYKDHDGDYKDHDIDYKDDDDK. الجدول 2: استكشاف الأخطاء وإصلاحها الجدول. قبل البدء في استكشاف الأخطاء وإصلاحها، تحقق مزدوج للتأكد من أن كل خطوة أساسية تم اتباعها. تتطلب بعض الخطوات في هذا البروتوكول مزيد من التحسين من الآخرين لتحقيق النتيجة المتوقعة. <a href="http://ecsource.jove.com/files/ftp_upload/55236/Book2.xlsx">الرجاء الضغط هنا لتحميل هذا الملف.</a>

Watch this Scientific Journal Video about Tandem Affinity Purification of Protein Complexes from Eukaryotic Cells at JoVE.com

Tandem Affinity Purification of Protein Complexes from Eukaryotic Cells

We describe here a novel, robust, and efficient tandem affinity purification (TAP) method for the expression, isolation, and characterization of protein complexes from eukaryotic cells. This protocol could be utilized for the biochemical characterization of discrete complexes as well as the identification of novel interactors and post-translational modifications that regulate their function.

جنبا إلى جنب تقارب تنقية البروتين المجمعات من خلايا حقيقية النواة

The purification of active protein-protein and protein-nucleic acid complexes is crucial for the characterization of enzymatic activities and de novo ...

tandem-affinity-purification-protein-complexes-from-eukaryotic

Nanyang Technological University

Research

JoVE Journal

Biochemistry

14.9K Views.  The University of Texas Southwestern Medical Center. We describe here a novel, robust, and efficient tandem affinity purification (TAP) method for the expression, isolation, and characterization of protein complexes from eukaryotic cells. This protocol could be utilized for the biochemical characterization of discrete complexes as well as the identification of novel interactors and post-translational modifications that regulate their function.

Video: Tandem Affinity Purification of Protein Complexes from Eukaryotic Cells

Protein Complex Affinity Capture from Cryomilled Mammalian Cells

Affinity capture is an effective technique for isolating endogenous protein complexes for further study. When used in conjunction with an antibody, this technique is also frequently referred to as immunoprecipitation. Affinity capture can be applied in a bench-scale and in a high-throughput context. When coupled with protein mass spectrometry, affinity capture has proven to be a workhorse of interactome analysis. Although there are potentially many ways to execute the numerous steps involved, the following protocols implement our favored methods. Two features are distinctive: the use of cryomilled cell powder to produce cell extracts, and antibody-coupled paramagnetic beads as the affinity medium. In many cases, we have obtained superior results to those obtained with more conventional affinity capture practices. Cryomilling avoids numerous problems associated with other forms of cell breakage. It provides efficient breakage of the material, while avoiding denaturation issues associated with heating or foaming. It retains the native protein concentration up to the point of extraction, mitigating macromolecular dissociation. It reduces the time extracted proteins spend in solution, limiting deleterious enzymatic activities, and it may reduce the non-specific adsorption of proteins by the affinity medium. Micron-scale magnetic affinity media have become more commonplace over the last several years, increasingly replacing the traditional agarose- and Sepharose-based media. Primary benefits of magnetic media include typically lower non-specific protein adsorption; no size exclusion limit because protein complex binding occurs on the bead surface rather than within pores; and ease of manipulation and handling using magnets.

Here we describe protocols to disrupt mammalian cells by solid-state milling at a cryogenic temperature, produce a cell extract from the resulting cell powder, and isolate protein complexes of interest by affinity capture upon antibody-coupled micron-scale paramagnetic beads.

البروتين مجمع القبض على الانجذاب من خلايا الثدييات Cryomilled

Affinity capture is an effective technique for isolating endogenous protein complexes for further study. When used in conjunction with an antibody, this ...

Resolving Affinity Purified Protein Complexes by Blue Native PAGE and Protein Correlation Profiling

Most proteins act in association with others; hence, it is crucial to characterize these functional units in order to fully understand biological processes. Affinity purification coupled to mass spectrometry (AP-MS) has become the method of choice for identifying protein-protein interactions. However, conventional AP-MS studies provide information on protein interactions, but the organizational information is lost. To address this issue, we developed a strategy to unravel the distinct functional assemblies a protein might be involved in, by resolving affinity-purified protein complexes prior to their characterization by mass spectrometry. Protein complexes isolated through affinity purification of a bait protein using an epitope tag and competitive elution are separated through blue native electrophoresis. Comparison of protein migration profiles through correlation profiling using quantitative mass spectrometry allows assignment of interacting proteins to distinct molecular entities. This method is able to resolve protein complexes of close molecular weights that might not be resolved by traditional chromatographic techniques such as gel filtration. With little more work than conventional AP-geLC-MS/MS, we demonstrate this strategy may in many cases be adequate for obtaining protein complex topological information concomitantly to identifying protein interactions.

Here we present protocols for affinity purification of protein complexes and their separation by blue native PAGE, followed by protein correlation profiling using label free quantitative mass spectrometry. This method is useful to resolve interactomes into distinct protein complexes.

حل تقارب تنقية البروتين المجمعات التي كتبها Blue الأصلية PAGE والبروتين الارتباط التنميط

Most proteins act in association with others; hence, it is crucial to characterize these functional units in order to fully understand biological ...

2 in 1: One-step Affinity Purification for the Parallel Analysis of Protein-Protein and Protein-Metabolite Complexes

Cellular processes are regulated by interactions between biological molecules such as proteins, metabolites, and nucleic acids. While the investigation of protein-protein interactions (PPI) is no novelty, experimental approaches aiming to characterize endogenous protein-metabolite interactions (PMI) constitute a rather recent development. Herein, we present a protocol that allows simultaneous characterization of the PPI and PMI of a protein of choice, referred to as bait. Our protocol was optimized for Arabidopsis cell cultures and combines affinity purification (AP) with mass spectrometry (MS)-based protein and metabolite detection. In short, transgenic Arabidopsis lines, expressing bait protein fused to an affinity tag, are first lysed to obtain a native cellular extract. Anti-tag antibodies are used to pull down protein and metabolite partners of the bait protein. The affinity-purified complexes are extracted using a one-step methyl tert-butyl ether (MTBE)/methanol/water method. Whilst metabolites separate into either the polar or the hydrophobic phase, proteins can be found in the pellet. Both metabolites and proteins are then analyzed by ultra-performance liquid chromatography-mass spectrometry (UPLC-MS or UPLC-MS/MS). Empty-vector (EV) control lines are used to exclude false positives. The major advantage of our protocol is that it enables identification of protein and metabolite partners of a target protein in parallel in near-physiological conditions (cellular lysate). The presented method is straightforward, fast, and can be easily adapted to biological systems other than plant cell cultures.

Protein-protein and protein-metabolite interactions are crucial for all cellular functions. Herein, we describe a protocol that allows parallel analysis of these interactions with a protein of choice. Our protocol was optimized for plant cell cultures and combines affinity purification with mass spectrometry-based protein and metabolite detection.

2 في 1: انجذاب تطهير لتحليل مواز للبروتين-بروتين والبروتين-المستقلب المجمعات من خطوة واحدة

Cellular processes are regulated by interactions between biological molecules such as proteins, metabolites, and nucleic acids. While the investigation of ...

Affinity Purification of Chloroplast Translocon Protein Complexes Using the TAP Tag

Chloroplast biogenesis requires the import of thousands of nucleus-encoded proteins into the plastid. The import of these proteins depends on the translocon at the outer (TOC) and inner (TIC) chloroplast membranes. The TOC and TIC complexes are multimeric and probably contain yet unknown components. One of the main goals in the field is to establish the complete inventory of TOC and TIC components. For the isolation of TOC-TIC complexes and the identification of new components, the preprotein receptor TOC159 has been modified N-terminally by the addition of the tandem affinity purification (TAP) tag resulting in TAP-TOC159. The TAP-tag is designed for two sequential affinity purification steps (hence "tandem affinity"). The TAP-tag used in these studies consists of a N-terminal IgG-binding domain derived from Staphylococcus aureus Protein A (ProtA) followed by a calmodulin-binding peptide (CBP). Between these two affinity tags, a tobacco etch virus (TEV) protease cleavage site has been included. Therefore, TEV protease can be used for gentle elution of TOC159-containing complexes after binding to IgG beads. In the protocol presented here, the second Calmodulin-affinity purification step was omitted. The purification protocol starts with the preparation and solubilization of total cellular membranes. After the detergent-treatment, the solubilized membrane proteins are incubated with IgG beads for the immunoisolation of TAP-TOC159-containing complexes. Upon binding and extensive washing, TAP-TOC159 containing complexes are cleaved and released from the IgG beads using the TEV protease whereby the S. aureus IgG-binding domain is removed. Western blotting of the isolated TOC159-containing complexes can be used to confirm the presence of known or suspected TOC and TIC proteins. More importantly, the TOC159-containing complexes have been used successfully to identify new components of the TOC and TIC complexes by mass spectrometry. The protocol that we present potentially allows the efficient isolation of any membrane-bound protein complex to be used for the identification of yet unknown components by mass spectrometry.

We here present a proven and tested protocol for the purification of chloroplast protein import complexes (TOC-TIC complex) using the TAP-tag. The one-step affinity-isolation protocol can potentially be applied to any protein and be used to identify new interaction partners by mass spectrometry.

انجذاب تطهير المجمعات البروتين ترانسلوكون بلاستيدات الخضراء باستخدام علامة الحنفية

Chloroplast biogenesis requires the import of thousands of nucleus-encoded proteins into the plastid. The import of these proteins depends on the ...

Identification of Protein Interacting Partners Using Tandem Affinity Purification

A critical and often limiting step in understanding the function of host and viral proteins is the identification of interacting cellular or viral protein partners. There are many approaches that allow the identification of interacting partners, including the yeast two hybrid system, as well as pull down assays using recombinant proteins and immunoprecipitation of endogenous proteins followed by mass spectrometry identification1. Recent studies have highlighted the utility of double-affinity tag mediated purification, coupled with two specific elution steps in the identification of interacting proteins. This approach, termed Tandem Affinity Purification (TAP), was initially used in yeast2,3 but more recently has been adapted to use in mammalian cells4-8.
As proof-of-concept we have established a tandem affinity purification (TAP) method using the well-characterized eukaryotic translation initiation factor eIF4E9,10.The cellular translation factor eIF4E is a critical component of the cellular eIF4F complex involved in cap-dependent translation initiation10. The TAP tag used in the current study is composed of two Protein G units and a streptavidin binding peptide separated by a Tobacco Etch Virus (TEV) protease cleavage sequence. The TAP tag used in the current study is composed of two Protein G units and a streptavidin binding peptide separated by a Tobacco Etch Virus (TEV) protease cleavage sequence8. To forgo the need for the generation of clonal cell lines, we developed a rapid system that relies on the expression of the TAP-tagged bait protein from an episomally maintained plasmid based on pMEP4 (Invitrogen). Expression of tagged murine eIF4E from this plasmid was controlled using the cadmium chloride inducible metallothionein promoter.
Lysis of the expressing cells and subsequent affinity purification via binding to rabbit IgG agarose, TEV protease cleavage, binding to streptavidin linked agarose and subsequent biotin elution identified numerous proteins apparently specific to the eIF4E pull-down (when compared to control cell lines expressing the TAP tag alone). The identities of the proteins were obtained by excision of the bands from 1D SDS-PAGE and subsequent tandem mass spectrometry. The identified components included the known eIF4E binding proteins eIF4G and 4EBP-1. In addition, other components of the eIF4F complex, of which eIF4E is a component were identified, namely eIF4A and Poly-A binding protein. The ability to identify not only known direct binding partners as well as secondary interacting proteins, further highlights the utility of this approach in the characterization of proteins of unknown function.

Tandem affinity purification is a robust approach for the identification of protein binding partners. As proof of concept, this methodology was applied to the well-characterized translation initiation factor eIF4E to co-precipitate the host cell factors involved in translation initiation. This method is easily adapted to any cellular or viral protein.

تحديد الشركاء البروتين عن طريق التفاعل جنبا الى جنب الانجذاب تنقية

A critical and often limiting step in understanding the function of host and viral proteins is the identification of interacting cellular or viral protein ...

Biology

Identification of Protein Complexes in Escherichia coli using Sequential Peptide Affinity Purification in Combination with Tandem Mass Spectrometry

Since most cellular processes are mediated by macromolecular assemblies, the systematic identification of protein-protein interactions (PPI) and the identification of the subunit composition of multi-protein complexes can provide insight into gene function and enhance understanding of biological systems1, 2. Physical interactions can be mapped with high confidence vialarge-scale isolation and characterization of endogenous protein complexes under near-physiological conditions based on affinity purification of chromosomally-tagged proteins in combination with mass spectrometry (APMS). This approach has been successfully applied in evolutionarily diverse organisms, including yeast, flies, worms, mammalian cells, and bacteria1-6. In particular, we have generated a carboxy-terminal Sequential Peptide Affinity (SPA) dual tagging system for affinity-purifying native protein complexes from cultured gram-negative Escherichia coli, using genetically-tractable host laboratory strains that are well-suited for genome-wide investigations of the fundamental biology and conserved processes of prokaryotes1, 2, 7. Our SPA-tagging system is analogous to the tandem affinity purification method developed originally for yeast8, 9, and consists of a calmodulin binding peptide (CBP) followed by the cleavage site for the highly specific tobacco etch virus (TEV) protease and three copies of the FLAG epitope (3X FLAG), allowing for two consecutive rounds of affinity enrichment. After cassette amplification, sequence-specific linear PCR products encoding the SPA-tag and a selectable marker are integrated and expressed in frame as carboxy-terminal fusions in a DY330 background that is induced to transiently express a highly efficient heterologous bacteriophage lambda recombination system10. Subsequent dual-step purification using calmodulin and anti-FLAG affinity beads enables the highly selective and efficient recovery of even low abundance protein complexes from large-scale cultures. Tandem mass spectrometry is then used to identify the stably co-purifying proteins with high sensitivity (low nanogram detection limits).
Here, we describe detailed step-by-step procedures we commonly use for systematic protein tagging, purification and mass spectrometry-based analysis of soluble protein complexes from E. coli, which can be scaled up and potentially tailored to other bacterial species, including certain opportunistic pathogens that are amenable to recombineering. The resulting physical interactions can often reveal interesting unexpected components and connections suggesting novel mechanistic links. Integration of the PPI data with alternate molecular association data such as genetic (gene-gene) interactions and genomic-context (GC) predictions can facilitate elucidation of the global molecular organization of multi-protein complexes within biological pathways. The networks generated for E. coli can be used to gain insight into the functional architecture of orthologous gene products in other microbes for which functional annotations are currently lacking.

Identification of Protein Complexes in Escherichia coli using Sequential Peptide Affinity Purification in Combination with Tandem Mass Spectrometry

Affinity purification of tagged proteins in combination with mass spectrometry (APMS) is a powerful method for the systematic mapping of protein interaction networks and for investigating the mechanistic basis of biological processes. Here, we describe an optimized sequential peptide affinity (SPA) APMS procedure developed for the bacterium Escherichia coli that can be used to isolate and characterize stable multi-protein complexes to near homogeneity even starting from low copy numbers per cell.

تحديد بروتين في مجمعات<em&gt; كولاي</em&gt; استخدام المتعاقبة تنقية تقارب الببتيد في تركيبة مع جنبا إلى جنب الطيف الكتلي

Since most cellular processes are mediated by macromolecular assemblies, the systematic identification of protein-protein interactions (PPI) and the ...

The MultiBac Protein Complex Production Platform at the EMBL

Proteomics research revealed the impressive complexity of eukaryotic proteomes in unprecedented detail. It is now a commonly accepted notion that proteins in cells mostly exist not as isolated entities but exert their biological activity in association with many other proteins, in humans ten or more, forming assembly lines in the cell for most if not all vital functions.1,2 Knowledge of the function and architecture of these multiprotein assemblies requires their provision in superior quality and sufficient quantity for detailed analysis. The paucity of many protein complexes in cells, in particular in eukaryotes, prohibits their extraction from native sources, and necessitates recombinant production. The baculovirus expression vector system (BEVS) has proven to be particularly useful for producing eukaryotic proteins, the activity of which often relies on post-translational processing that other commonly used expression systems often cannot support.3 BEVS use a recombinant baculovirus into which the gene of interest was inserted to infect insect cell cultures which in turn produce the protein of choice. MultiBac is a BEVS that has been particularly tailored for the production of eukaryotic protein complexes that contain many subunits.4 A vital prerequisite for efficient production of proteins and their complexes are robust protocols for all steps involved in an expression experiment that ideally can be implemented as standard operating procedures (SOPs) and followed also by non-specialist users with comparative ease. The MultiBac platform at the European Molecular Biology Laboratory (EMBL) uses SOPs for all steps involved in a multiprotein complex expression experiment, starting from insertion of the genes into an engineered baculoviral genome optimized for heterologous protein production properties to small-scale analysis of the protein specimens produced.5-8 The platform is installed in an open-access mode at EMBL Grenoble and has supported many scientists from academia and industry to accelerate protein complex research projects.

Protein complexes catalyze key cellular functions. Detailed functional and structural characterization of many essential complexes requires recombinant production. MultiBac is a baculovirus/insect cell system particularly tailored for expressing eukaryotic proteins and their complexes. MultiBac was implemented as an open-access platform, and standard operating procedures developed to maximize its utility.

على البروتين MultiBac مجمع منصة الإنتاج في EMBL

Proteomics  research revealed the impressive complexity of eukaryotic proteomes in  unprecedented detail. It is now a commonly accepted notion that ...

Identifying Protein-protein Interaction in Drosophila Adult Heads by Tandem Affinity Purification (TAP)

Genetic screens conducted using Drosophila melanogaster (fruit fly) have made numerous milestone discoveries in the advance of biological sciences. However, the use of biochemical screens aimed at extending the knowledge gained from genetic analysis was explored only recently. Here we describe a method to purify the protein complex that associates with any protein of interest from adult fly heads. This method takes advantage of the Drosophila GAL4/UAS system to express a bait protein fused with a Tandem Affinity Purification (TAP) tag in fly neurons in vivo, and then implements two rounds of purification using a TAP procedure similar to the one originally established in yeast1 to purify the interacting protein complex. At the end of this procedure, a mixture of multiple protein complexes is obtained whose molecular identities can be determined by mass spectrometry. Validation of the candidate proteins will benefit from the resource and ease of performing loss-of-function studies in flies. Similar approaches can be applied to other fly tissues. We believe that the combination of genetic manipulations and this proteomic approach in the fly model system holds tremendous potential for tackling fundamental problems in the field of neurobiology and beyond.

Identifying Protein-protein Interaction in Drosophila Adult Heads by Tandem Affinity Purification TAP

Drosophila is famous for its powerful genetic manipulation, but not for its suitability of in-depth biochemical analysis. Here we present a TAP-based procedure to identify interacting partners of any protein of interest from the fly brain. This procedure can potentially lead to new avenues of research.

تحديد البروتين البروتين التفاعل في<em&gt; ذبابة الفاكهة</em&gt; رؤساء الكبار حسب جنبا الى جنب الانجذاب تنقية (وات)

Genetic screens conducted using Drosophila melanogaster (fruit fly) have made numerous milestone discoveries in the advance of biological sciences. ...

Purification of Native Complexes for Structural Study Using a Tandem Affinity Tag Method

Affinity purification approaches have been successful in isolating native complexes for proteomic characterization. Structural heterogeneity and a degree of compositional heterogeneity of a complex do not usually impede progress in conducting such studies. In contrast, a complex intended for structural characterization should be purified in a state that is both compositionally and structurally homogeneous as well as at a higher concentration than required for proteomics. Recently, there have been significant advances in the application of electron microscopy for structure determination of large macromolecular complexes. This has heightened interest in approaches to purify native complexes of sufficient quality and quantity for structural determination by electron microscopy. The Tandem Affinity Purification (TAP) method has been optimized to extract and purify an 18-subunit, ~ 0.8 MDa ribonucleoprotein assembly from budding yeast (Saccharomyces cerevisiae) suitable for negative stain and electron cryo microscopy. Herein is detailed the modifications made to the TAP method, the rationale for making these changes, and the approaches taken to assay for a compositionally and structurally homogeneous complex.

The Tandem Affinity Purification (TAP) method has been used extensively to isolate native complexes from cellular extract, primarily eukaryotic, for proteomics. Here, we present a TAP method protocol optimized for purification of native complexes for structural studies.

تنقية مجمعات الأصلية للدراسة الهيكلية باستخدام طريقة العلامة جنبا الى جنب الانجذاب

Affinity purification approaches have been successful in isolating native complexes for proteomic characterization. Structural heterogeneity and a degree ...

Tandem Affinity Purification Assay to Study Protein-Protein Interactions

Source: Ma, Z., et al. <a href="https://app.jove.com/v/55236">Tandem Affinity Purification of Protein Complexes from Eukaryotic Cells.</a> J. Vis. Exp. (2017).
This video demonstrates tandem affinity purification &#8212; a technique to purify protein complexes from eukaryotic cells to study protein-protein interaction. The complex contains two proteins labeled with different epitope tags. Upon the purification of the complex using two resins with an affinity for the two different tags in a sequential manner, the presence of both proteins in the elute confirms the interaction between the two.

مقايسة تنقية التقارب الترادفي لدراسة تفاعلات البروتين والبروتين

Source: Ma, Z., et al. Tandem Affinity Purification of Protein Complexes from Eukaryotic Cells. J. Vis. Exp. (2017).
This video demonstrates tandem ...

جنبا إلى جنب تقارب تنقية البروتين المجمعات من خلايا حقيقية النواة

Summary

Explore More Videos

Chapters in this video