עבודת מחקר שבוצעה במעבדה נתמכה על ידי מענקי קרן המחקר - פלנדריה (FWO; מספרי מענק G.0545.08 וG.0298.11), תכנית הפולנים המשיכה הבינאוניברסיטאי (מדיניות מדע בלגית; מענק מספר P6/28 וP7/13) ומוטבע בקהילת מחקר FWO נתמכת. CDH הוא פוסט דוקטורט של קרן המחקר - פלנדריה (FWO). המחברים מודים מאוד לכל חברי ההווה ובעבר של המעבדה של איתות מולקולרית ותאית (KU לובן), ד&quot;ר SP Srinivas (אוניברסיטת אינדיאנה הספר לאופטומטריה, ארה&quot;ב), המעבדה של ד&quot;ר Leybaert (אוניברסיטת גנט) ושל ד&quot;ר Vinken (Vub) שסיפק דיונים מועילים, מותאם נהלים או היו מעורב בפיתוח כלים לחקר hemichannels connexin.

1. בידוד של תאי אנדותל הקרניים לפני שיתחיל: לבודד את התאים מהעיניים טריות, המתקבלות מהמטבחיים מקומי, בהקדם האפשרי לאחר enucleating העין. ודא כי העין הייתה enucleated מפרה של בן 18 חודשים, חמש פוסט המורט והשתמרו בתמיסת מלח מאוזנת של ארל דקות מקסימליים - תמיסת יוד 1% ב 4 ° C להובלה למעבדה. <ol style=";text-align:right;direction:rtl"><li style=";text-align:right;direction:rtl"> קח עין מתמיסת מלח מאוזנת של ארל - תמיסת יוד 1% ולמקם אותו בצלחת פטרי (100 מ&quot;מ X 20). </li><li style=";text-align:right;direction:rtl"> לעקר את העין עם תמיסה המכילה 70% אתנול ולשטוף עם תמיסת מלח מאוזנת של ארל המכילה 1% יוד. </li><li style=";text-align:right;direction:rtl"> משלב זה ואילך, לעבוד במנדף סטרילי. בזהירות לנתח את הקרנית מהעין ולמקם אותו בצלחת פטרי (35 x 10 מ&quot;מ) המכילה תמיסת מלח מאוזנת של ארל, עם שכבת תאי האפיתל פונה כלפי מעלה. להסיר כל Sti רקמת איריס שנותר בזהירותיהיה מחובר לקרנית במידת צורך. </li><li style=";text-align:right;direction:rtl"> העבר את הקרנית לתמיסת מלח מאוזנת של ארל אחר המכילה צלחת פטרי עם שכבת תאי האנדותל כלפי מעלה ולשטוף פעמיים עם תמיסת מלח מאוזנת של ארל. </li><li style=";text-align:right;direction:rtl"> העבר את הקרנית עם שכבת האנדותל פונה כלפי מעלה לשעון חול, שהוא מאכל בצורת כוס, ולכסות אותו עם מדיום גידול. מדיום הגידול מורכב מבינוני השתנה Dulbecco של הנשר המכיל גלוקוז 25 מ&quot;מ, 10% בסרום שור עוברי, 6.6% L-גלוטמין, 2.5 מיקרוגרם / מיליליטר amphotericin-B ו 1% תערובת האנטיביוטיקה antimycotic המכיל 10,000 יחידות / מ&quot;ל ​​של פניצילין, 10,000 מיקרוגרם / מ&quot;ל ​​של סטרפטומיצין, ו -25 מיקרוגרם / מיליליטר amphotericin B. </li><li style=";text-align:right;direction:rtl"> הסר את המדיום עם טפטפת יניקה. </li><li style=";text-align:right;direction:rtl"> החל μl 300 של פתרון טריפסין (0.5 גר &#39;/ ל&#39;) לשכבת האנדותל של הקרנית (כל הצעדים הכוללים טריפסין נעשים באמצעות אותו הריכוז). </li><li style=";text-align:right;direction:rtl"> הנח את שעון חול המכיל את הקרנית בצלחת פטרי מכוסה ושם אותו בincubator למשך 30 דקות בשעה 37 ° C ו 5% CO 2. </li><li style=";text-align:right;direction:rtl"> בעדינות לגרד את תאי האנדותל מקרנית עם זכוכית פיפטה פסטר בצורת וו אש מלוטשת בשכונת סטרילי. </li><li style=";text-align:right;direction:rtl"> תמצוץ את התמיסה המכילה את תאי האנדותל ולהוסיף אותו לתרבות צלוחיות (25 ס&quot;מ 2) המכילות 4 מ&quot;ל של מדיום התרבות. </li><li style=";text-align:right;direction:rtl"> החל μl 300 של מדיום גידול לקרנית וחזור גירוד ולהוסיף תמיסה המכילה את תאי האנדותל לבקבוק התרבות. </li><li style=";text-align:right;direction:rtl"> חזור על שלב זה סופי (1.11) פעם נוספת. </li><li style=";text-align:right;direction:rtl"> הנח את תרבות צלוחיות המכילים את תאי האנדותל בקרנית במדיום הגידול בחממה ב 37 ° C ו 5% CO 2. </li><li style=";text-align:right;direction:rtl"> לאחר יומיים, להוסיף 6 מ&quot;ל של מדיום התרבות. </li><li style=";text-align:right;direction:rtl"> רענן מדיום גידול כל יום שני. </li></ol> 2. תרבית תאים <ol style=";text-align:right;direction:rtl"><li style=";text-align:right;direction:rtl"> הסר את מדיום התרבות לשטוף את התאים פעמיים עם הפתרון של ארל מאוזן מלח, כאשר confluency הוא הגיע (באבו10 ימים לאחר בידוד t). </li><li style=";text-align:right;direction:rtl"> הוסף פתרון 1.5 מ&quot;ל טריפסין לתאים כדי לנתק אותם ומניחים את הבקבוק בחממה (37 מעלות צלזיוס, 5% CO 2) במשך 3 עד 4 דקות. </li><li style=";text-align:right;direction:rtl"> הוסף 12 מ&quot;ל של מדיום גידול. פיפטה שלוש הפעמים בינוניות פנימה והחוצה כדי לפזר את התאים ולספור את התאים. </li><li style=";text-align:right;direction:rtl"> תאי זרע עם חלק קטן משתנה בהתאם לצפיפות התא ולשים אותם בחממה. הכן שתי שקופיות היטב בליעה (בשטח של 4.2 ס&quot;מ 2) עם ספירת תאים של 165,000 תאים (תא לצפיפות 39,286 2 ס&quot;מ). הכן 80 ס&quot;מ 2 צלוחיות תרבות למעבר חדש בצפיפות של 6,250 ל2 ס&quot;מ, ולהוסיף מדיום התרבות טרי עד נפח כולל של 25 מ&quot;ל. </li><li style=";text-align:right;direction:rtl"> רענן בינונית כל יומיים. </li><li style=";text-align:right;direction:rtl"> Confluency של שכבת התאים הוא הגיע לאחר 3 עד 4 ימים. להשתמש בתאים לניסויים. </li><li style=";text-align:right;direction:rtl"> כאשר confluency של שכבת התאים בצלוחיות הוא הגיע, חזור על שלבי 2.1-2.6. ניתן להשתמש בתרביות תאים עד חלוף 2 Fאו ניסויים. </li></ol> 3. גירוי מכאני לגל סיד התרמה <ol style=";text-align:right;direction:rtl"><li style=";text-align:right;direction:rtl"> לטעון את התאים בשקופית הקבורים עם 10 מיקרומטר Fluo-4 בבוקר בפוספט שנאגרו מלוח למשך 30 דקות ב 37 מעלות צלזיוס בזמן הטלטול בעדינות. </li><li style=";text-align:right;direction:rtl"> הסר Fluo-04:00 פתרון, לשטוף את התאים חמש פעמים עם פוספט שנאגרו מלוח, דגירה התאים עם פוספט שנאגרו מלוח ולהשאיר את התאים לפחות 5 דקות בטמפרטורת חדר לפני המדידה. </li><li style=";text-align:right;direction:rtl"> אקסייט ב 488 ננומטר עם ארגון לייזר ושימוש קורה המפצל HFT 488, לאסוף את פליטת הקרינה ב530 ננומטר באמצעות longpass פליטת מסנן LP 505, קבע את חריר במינימום. השתמש אובייקטיבי 40X טבילת שמן (אוויר, 1.2 NA). בניסויים עם ARL-67156, השתמש אובייקטיבי 10X (אוויר, 0.3 NA). </li><li style=";text-align:right;direction:rtl"> לחפש תחום שבו התאים ומחוברות במיקרוסקופ confocal. </li><li style=";text-align:right;direction:rtl"> עמדת פיפטה כך שזה ב 45 מעלות ביחס לשקופית הבליעה ונוגע בקרום התא.לעורר גירוי מכאני קצר (≈ 1 שניות) לתא בודד. הגירוי מכאני מורכב מעיוות חריפה, קצר טווח של התא על ידי נגיעה פחות מ -1% של קרום התא בקצרה עם micropipette כוס (קוטר קצה &lt;1 מיקרומטר) מצמידים את nanopositioner גביש פיזואלקטריים, המופעל באמצעות מגבר שהוא רכוב על מיקרו מניפולטור. את micropipettes עשוי הזכוכית עם חולץ microelectrode. ודא כי nanopositioner מופעל על ידי מתח בין 0.2 ו 1.5 V במהלך הגירוי מכאני. מתח גבוה מ -1.5 וולט יכול לגרום לניזק לתאים. לכל סוג תא ולמצבו, המתח האופטימלי לגירוי מכאני ללא נזק לתאים צריך להיקבע בזהירות על ידי יישום שורה של מתחים החל מ נמוך (0.2 וולט) למתח גבוה (1.5 וולט). המתח הוא מדד לעוצמת הגירוי שכן מתח זה קובע את הלחץ מכאני ומתח שמוחלים על קרום התא.כוח של הגירוי מכאני יכול להיות מחושב על ידי הכפלת הלחץ מכאני עם האזור. מאז הן האזור (&lt;3.14 מיקרומטר 2) ולחץ מכאני הם נמוכים מאוד, כוח של הגירוי מכאני הוא נמוך. (שים לב שכאשר תא פגום, דליפות הקרינה אל מחוץ לתא והתא הופכים כהות.) </li><li style=";text-align:right;direction:rtl"> למדוד שינויים מרחביים ב[ Ca 2 +] אני בעקבות גירוי מכאני עם מיקרוסקופ confocal. </li><li style=";text-align:right;direction:rtl"> לאסוף ולאחסן את תמונות. </li><li style=";text-align:right;direction:rtl"> צייר אזור polygonal עניין להגדיר את שטח הפנים הכולל של תאים מגיבים (האזור פעיל, א.א.) באמצעות התוכנה של מיקרוסקופ confocal. </li></ol>

יש מחברים אין לחשוף.

בכתב יד זה, אנו מתארים שיטה פשוטה למדידת 2 + אינטר התפשטות גל CA בmonolayers של תאי האנדותל בקרנית שור ראשוניים על ידי מתן גירוי מכאני מקומית ומבוקר באמצעות micropipette. תאי מגורה מכאני מגיבים בעלייה מקומית בIP תאי 3 וCa 2 +, אשר שניהם הם מולקולות איתות תאיות חיוניות...

תקשורת בין תאית ואיתות חיונית לתיאום של תהליכים פיסיולוגיים בתגובה לאגוניסטים תאיים ברמה 1,2 כל האיבר והרקמה. הדרך הישירה ביותר של תקשורת בין תאית נוצרה על ידי ההתרחשות של צמתים פער. צמתים פער הם לוחות של ערוצי צומת גאפ, שהם ערוצים חלבוניים שהוקמו על ידי העגינה הראש בראש של שתי connexin (CX) hemichannels של תאים סמוכים 3,4 (איור 1). צמתים פער לאפשר המעבר של מולקולות איתות קטנות עם משקל מולקולרי של פחות מ -1.5 kDa, כולל Ca 2 + או ה-IP של 3 5, מה שגרם וויסות Ca 2 + שחרור מהחנויות תאיות של התאים השכנים 6 (איור 2). ערוצי צומת פער מוסדרים היטב על ידי אינטראקציות חלבון ותוך מולקולאריים ועל ידי תהליכי איתות תאיים, כמו שינוי והחיזורזירחון 7. GJS להקל על התגובה מתואמת של תאים מחוברים, ובכך מתנהג כמו כימי וsyncytium חשמל. לדוגמה, הפצה של פוטנציאל פעולת לב על פני myocytes פרוזדורים וחדרים מתווכת על ידי ערוצי 85 GJ מבוסס CX. CXS יש לא רק תפקיד כערוצי צומת פער, אלא גם ליצור hemichannels מזווג, ובכך מתפקד כערוצים בקרום בדומה לערוצים רגילים יון 8-10 (איור 1). Hemichannels להשתתף באיתות בין תאים שכנים paracrine על ידי שליטה בחילופי יונים ומולקולות איתות בין סביבת התוך תאית ו. בסוגי תאים רבים (כמו תאי אפיתל, תאי osteoblastic, האסטרוציטים, תאי אנדותל, וכו &#39;) ואיברים (כמו מוח, כבד, רשתית, שבלול וכלי דם), אינטר Ca 2 + גלים הם יסוד לתיאום של תגובות תאיות <sup&gt; 11. עליות בCa 2 + רמות תאיות בתא מסוים אינן מוגבלות לתא זה, אבל להפיץ לתאים השכנים בסביבה, וכך לבסס Ca אינטר 2 + גל 12,13. Ca 2 + אלה אינטר גלים חשובים לויסות פיזיולוגית נורמלית של שכבות תאים כsyncytium וdysregulation נקשר עם תהליכי pathophysiological 11. באנדותל ואפיתל קרני, קבוצות שונות 14-24, כולל 25-33 משלנו, חקרו את המנגנונים ואת התפקידים של תקשורת בין תאית. בתאים שאינם נרגשים, כמו תאי אנדותל בקרנית, שני מצבים שונים של תקשורת בין תאית להתרחש 28,29, כלומר פער תקשורת בין תאית junctional ותקשורת בין תאית paracrine. תקשורת בין תאית junctional פער כרוכה בחילופים ישירים של מולקולות איתות דרך צמתים פער 7. פער juncתקשורת בין תאית tional היא קריטית לשמירה על הומאוסטזיס רקמות, השליטה התפשטות תאים, והקמה מסונכרנת תגובה ללחץ תאי 10,34,35. במספר פתולוגיות, צימוד צומת פער מצטמצם עקב פגום CXS, ומשפיע על פער תקשורת בין תאית 36 junctional בזאת. זה מדגיש את החשיבות והשפעה של תקשורת בין תאית junctional פער באורגניזמים תאיים. בניגוד לתקשורת בין תאית junctional פער, תקשורת בין תאית paracrine אינה תלויה בפרד תאי תאים, שכן היא כוללת את שחרורו של שליחים תאיים diffusible (איור 2). סוגים שונים של מולקולות איתות משתחררים בחלל החוץ התאי על ידי תאי איתות. המולקולה לאחר מכן הועברה לתא היעד שבו הוא זוהה על ידי חלבון קולטן ספציפי. כתוצאה מכך מורכבת קולט האותות גורם לתגובה תאית, אשרהוא הופסק על ידי הסרת האות, איון או הפחתת רגישות. שליחים תאיים lipophilic פורסם איתות לחדור את הקרום ולפעול על קולטני תאיות. בניגוד לכך, שליחים הידרופילי לא לחצות את קרום הפלזמה של התא להגיב, אבל לפעול כיגנד שנקשר לחלבוני פני שטח, הביעו הקולטן, אשר לאחר מכן להעביר את האות לסביבה תאית. שלוש משפחות עיקריות של חלבונים פני תא קולטן להשתתף בתהליך הזה: קשור יון ערוצים, אנזים צמוד וצמוד לחלבון G. מולקולת השליח שוחרר יכולה לפעול על הקולטנים של אותו התא (autocrine), על תאי המטרה בסמיכות (paracrine), או על תאי היעד רחוקים שדורשים מערכת הדם (האנדוקרינית). בסוגי תאים רבים, כולל קרנית האנדותל 28,29, ה-ATP הוא אחד הגורמים העיקריים paracrine הידרופילי, המניעים את ההתפשטות של אינטר Ca 2 + גלים 37-40. משךעיוות מכאנית ing, היפוקסיה, דלקת או גירוי על ידי סוכנים שונים, ניתן לשחרר ATP מהתאים בריאים 41-44 בתגובה למאמץ גזירה, מתיחה, או נפיחות האוסמוטי 44,45. מנגנוני ה-ATP-הפצה אחרות כבר הניחו, כולל exocytosis לפוחי 44 ושפע של מנגנוני הובלה, כגון ה-ATP מחייבים קלטות (ABC) מובילים, ערוצי אניון מתח התלויים plasmalemmal 46, P2X7 ערוצי קולט 47,48, כמו גם connexin hemichannels 49-52 וpannexin hemichannels 43,49,53. ATP תאי יכול להיות במהירות הידרוליזה לADP, AMP ואדנוזין 54,55 ידי ectonucleotidases שנמצאים בסביבה תאית. ה-ATP שפורסם extracellularly וADP המטבוליט שלה 56 תהיה להפיץ באמצעות דיפוזיה. האינטראקציה הבאה של נוקלאוטידים אלה עם קולטני purinergic בתאים השכנים הייתה מעורבת בעמ &#39;ropagation של אינטר Ca 2 + גלים 28,37,51. שני סוגים של קולטנים שונים purinergic נוכחים: אדנוזין הוא ליגנד הטבעי העיקרי לP1-purinoceptors, בעוד הן פורין (ATP, ADP) ופירימידין (UTP, UDP) נוקלאוטידים ביותר לפעול על P2-purinoceptors 57. תקשורת בין תאית יכולה להיחקר על ידי שיטות שונות כגון טעינה לגרד, העברת צבע, משחררות רפרוף מקומית של אגוניסטים כמו IP 3 וCa 2 +, גירוי מכאני, וכו &#39;. כאן אנו מתארים את המחקר של Ca 2 + התפשטות גל שהושרו על ידי גירוי מכאני של תא בודד. היתרון של לימוד 2 + התפשטות גל CA על ידי גירוי מכאני הוא שהיא מספקת כלי קל לכמת את התפשטות Ca 2 + גל לאורך זמן, והיא מאפשרת השוואת כמותית pretreatments של התאים שונים. באנדותל בקרנית, אלה Ca 2 + אינטר גלים לאפשר שיתוףתגובה מתואמת מmonolayer, מתנהגת בזאת כמנגנון הגנה אפשרי של האנדותל של הקרנית שאינם משובי עוזרים האנדותל לעמוד לחצים תאיים במהלך ניתוח תוך עיני, או בחשיפה למתווכים דלקתיים במהלך דחייה של מערכת חיסון או אובאיטיס 58,59.

<table><tbody><tr><td>Earle&#039;s Balanced Salt Solution (EBSS)</td><td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td><td>14155-048</td><td></td></tr><tr><td>Iodine</td><td>Sigma-Aldrich (Deisenhofen, Germany)</td><td>38060-1EA</td><td></td></tr><tr><td>Dulbecco&#039;s Modified Eagle&#039;s Medium (DMEM)</td><td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td><td>11960-044</td><td></td></tr><tr><td>L-glutamine (Glutamax)</td><td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td><td>35050-038</td><td></td></tr><tr><td>Amphotericin-B</td><td>Sigma-Aldrich (Deisenhofen, Germany)</td><td>A2942</td><td></td></tr><tr><td>Antibiotic-antimycotic mixture</td><td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td><td>15240-096</td><td></td></tr><tr><td>Trypsin</td><td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td><td>25300-054</td><td></td></tr><tr><td>Dulbecco&#039;s PBS</td><td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td><td>14190-091</td><td></td></tr><tr><td>Fluo-4 AM</td><td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td><td>F14217</td><td></td></tr><tr><td>ARL-67156 (6-N,N-Diethyl-b,g-dibromomethylene-D-ATP) </td><td>Sigma-Aldrich (Deisenhofen, Germany)</td><td>A265</td><td></td></tr><tr><td>Apyrase VI</td><td>Sigma-Aldrich (Deisenhofen, Germany)</td><td>A6410</td><td></td></tr><tr><td>Apyrase VII</td><td>Sigma-Aldrich (Deisenhofen, Germany)</td><td>A6535</td><td></td></tr><tr><td>Gap26 (VCYDKSFPISHVR)</td><td>Custom peptide synthesis</td><td></td><td></td></tr><tr><td>Gap27 (SRPTEKTIFII)</td><td>Custom peptide synthesis</td><td></td><td></td></tr><tr><td>Control Peptide (SRGGEKNVFIV)</td><td>Custom peptide synthesis</td><td></td><td></td></tr><tr><td>siRNA1 Cx43 (sense: 5&#039;GAAGGAGGAGGAACU-CAAAdTdT) </td><td>Annealed siRNA was purchased at Eurogentec (Luik, Belgium)</td><td></td><td></td></tr><tr><td>siRNA2 Cx43 (sense: 5&#039;CAAUUCUUCCUGCCGCAAUdTdT) </td><td>Annealed siRNA was purchased at Eurogentec (Luik, Belgium)</td><td></td><td></td></tr><tr><td>siRNA scramble: scrambled sequence of siCx43-1 (sense: 5&#039;GGUAAACG-GAACGAGAAGAdTdT) </td><td>Annealed siRNA was purchased at Eurogentec (Luik, Belgium)</td><td></td><td></td></tr><tr><td>TAT-L2 (TAT- DGANVDMHLKQIEIKKFKYGIEEHGK)</td><td>Thermo Electron (Ulm, Germany)</td><td></td><td></td></tr><tr><td>TAT-L2-H126K/I130N (TAT-DGANVDMKLKQNEIKKFKYGIEEHGK) </td><td>Thermo Electron (Ulm, Germany)</td><td></td><td></td></tr><tr><td></td><td></td><td></td><td></td></tr><tr><td>Two chambered glass slides</td><td>Laboratory-Tek Nunc (Roskilde, Denmark)</td><td>155380</td><td></td></tr><tr><td>Confocal microscope </td><td>Carl Zeiss Meditec (Jena, Germany)</td><td>LSM510</td><td></td></tr><tr><td>Piez&amp;#8211;lectric crystal nanopositioner (Piezo Flexure NanoPositioner)</td><td>PI Polytech (Karlsruhe, Germany)</td><td>P-280</td><td></td></tr><tr><td>HVPZT-amplifier</td><td>PI Polytech (Karlsruhe, Germany)</td><td>E463 HVPZT-amplifier</td><td></td></tr><tr><td>Glass tubes (glass replacement 3.5 nanoliter)</td><td>World Precision Instruments, Inc. Sarasota, Florida, USA</td><td>4878</td><td></td></tr><tr><td>Micr&amp;#8211;lectrode puller </td><td>Zeitz Instrumente (Munchen, Germany)</td><td>WZ DMZ-Universal Puller</td><td></td></tr></tbody></table>

mechanical stimulation-induced calcium wave propagation in cell monolayers: the example of bovine corneal endothelial cells

תקשורת בין תאית היא חיונית לתיאום של תהליכים פיסיולוגיים בין תאים במגוון רחב של איברים ורקמות, ובכלל זה המוח, הכבד, הרשתית, השבלול וכלי הדם. בהגדרות ניסוי, אינטר Ca 2 + גלים יכול להיות שהושרו על ידי יישום גירוי מכאני לתא בודד. זה מוביל לשחרור של מולקולות האיתות תאיות IP 3 ו Ca 2 + שיזמו את ההתפשטות של Ca 2 + גל מעגלי מתא מגורה מכאני לתאים השכנים. את המסלולים המולקולריים המרכזיים השולטים 2 התפשטות אינטר + גל Ca מסופקים על ידי ערוצי צומת פער עד להעברה הישירה של 3-IP ועל ידי hemichannels דרך שחרורו של ה-ATP. זיהוי והאפיון של המאפיינים והרגולציה של connexin שונה וisoforms pannexin כערוצי צומת גאפ וhemichannels מותר על ידי quantification של התפשטות Ca אינטר 2 + גל, siRNA, ושימוש במעכבים של ערוצי צומת גאפ וhemichannels. כאן, אנו מתארים שיטה למדידה אינטר Ca 2 + גל בmonolayers של תאי האנדותל בקרנית עיקריים עמוסים Fluo4-AM בתגובה לגירוי מכאני מבוקר ומקומי עורר על ידי עיוות חריפה, קצר טווח של התא כתוצאה נגיעה של קרום התא עם micropipette זכוכית micromanipulator שליטה בקוטר קצה מיקרומטר פחות מ 1. אנו גם מתארים את הבידוד של תאים ראשוניים שור קרנית האנדותל והשימוש בו כמערכת מודל להערכת פעילות Cx43-hemichannel ככוח מונע לאינטר Ca 2 + גלים דרך שחרורו של ה-ATP. לבסוף, אנו דנים בשימוש, יתרונות, מגבלות וחלופות של שיטה זו בהקשר של ערוץ צומת פער ומחקר hemichannel.

כל הניסויים מבוצעים בעמידה בכל ההנחיות הרלוונטיות, תקנות וגופים הרגולטוריים ואת הפרוטוקול שמפגינים מבוצע תחת הדרכתו ואישורו של הטיפול בבעלי החיים ועדת שימוש בלובן KU. בתאי אנדותל בקרנית שור (BCEC), צמתים פער תפקודיים באים לידי ביטו...

Watch this Scientific Journal Video about Mechanical Stimulation-induced Calcium Wave Propagation in Cell Monolayers: The Example of Bovine Corneal Endothelial Cells at JoVE.com

Mechanical Stimulation-induced Calcium Wave Propagation in Cell Monolayers: The Example of Bovine Corneal Endothelial Cells

Ca אינטר<sup&gt; 2 +</sup&gt; גלים מונעים על ידי ערוצי צומת גאפ וhemichannels. כאן, אנו מתארים שיטה למדידת Ca אינטר<sup&gt; 2 +</sup&gt; גלים בmonolayers הסלולרי בתגובה לגירוי מכאני מתא בודד מקומי והיישום שלה כדי לחקור את המאפיינים והרגולציה של ערוצי צומת גאפ וhemichannels.

הרבייה מכאנית מושרה גירוי סיד גל בmonolayers הסלולרי: דוגמה לתאי אנדותל קרני שור

Intercellular communication is essential for the coordination of physiological processes between cells in a variety of organs and tissues, including the ...

mechanical-stimulation-induced-calcium-wave-propagation-cell

Research

JoVE Journal

Biology

16.2K Views.  KU Leuven. Ca אינטר 2 + גלים מונעים על ידי ערוצי צומת גאפ וhemichannels. כאן, אנו מתארים שיטה למדידת Ca אינטר 2 + גלים בmonolayers הסלולרי בתגובה לגירוי מכאני מתא בודד מקומי והיישום שלה כדי לחקור את המאפיינים והרגולציה של ערוצי צומת גאפ וhemichannels.

Video: Mechanical Stimulation-induced Calcium Wave Propagation in Cell Monolayers: The Example of Bovine Corneal Endothelial Cells

In Vitro and In Vivo Models to Study Corneal Endothelial-mesenchymal Transition

Corneal endothelial cells (CECs) play a crucial role in maintaining corneal clarity through active pumping. A reduced CEC count may lead to corneal edema and diminished visual acuity. However, human CECs are prone to compromised proliferative potential. Furthermore, stimulation of cell growth is often complicated by gradual endothelial-mesenchymal transition (EnMT). Therefore, understanding the mechanism of EnMT is necessary for facilitating the regeneration of CECs with competent function. In this study, we prepared a primary culture of bovine CECs by peeling the CECs with Descemet's membrane from the corneal button and demonstrated that bovine CECs exhibited the EnMT process, including phenotypic change, nuclear translocation of &#946;-catenin, and EMT regulators snail and slug, in the in vitro culture. Furthermore, we used a rat corneal endothelium cryoinjury model to demonstrate the EnMT process in vivo. Collectively, the in vitro primary culture of bovine CECs and in vivo rat corneal endothelium cryoinjury models offers useful platforms for investigating the mechanism of EnMT.

In Vitro and In Vivo Models to Study Corneal Endothelial-mesenchymal Transition

A primary culture of bovine corneal endothelial cells was used to investigate the mechanism of corneal endothelial-mesenchymal transition. Furthermore, a rat corneal endothelium cryoinjury model was used to demonstrate corneal endothelial-mesenchymal transition in vivo.

במבחנה מודלים Vivo ללמוד קרנית האנדותל-mesenchymal מעבר

Corneal endothelial cells (CECs) play a crucial role in maintaining corneal clarity through active pumping. A reduced CEC count may lead to corneal edema ...

Developmental Biology

Growth of Human and Sheep Corneal Endothelial Cell Layers on Biomaterial Membranes

Corneal endothelial cell cultures have a tendency to undergo epithelial-to-mesenchymal transition (EMT) after loss of cell-to-cell contact. EMT is deleterious for the cells as it reduces their ability to form a mature and functional layer. Here, we present a method for establishing and subculturing human and sheep corneal endothelial cell cultures that minimizes the loss of cell-to-cell contact. Explants of corneal endothelium/Descemet&#39;s membrane are taken from donor corneas and placed into tissue culture under conditions that allow the cells to collectively migrate onto the culture surface. Once a culture has been established, the explants are transferred to fresh plates to initiate new cultures. Dispase II is used to gently lift clumps of cells off tissue culture plates for subculturing. Corneal endothelial cell cultures that have been established using this protocol are suitable for transferring to biomaterial membranes to produce tissue-engineered cell layers for transplantation in animal trials. A custom-made device for supporting biomaterial membranes during tissue culture is described and an example of a tissue-engineered graft composed of a layer of corneal endothelial cells and a layer of corneal stromal cells on either side of a collagen type I membrane is presented.

This protocol describes the critical steps required to establish and grow corneal endothelial cell cultures from explants of human or sheep tissue. A method for subculturing corneal endothelial cells on membranous biomaterials is also presented.

צמיחת הקרנית של האדם והכבשים שכבות של תאי-על ביומטריה

Corneal endothelial cell cultures have a tendency to undergo epithelial-to-mesenchymal transition (EMT) after loss of cell-to-cell contact. EMT is ...

Bioengineering

Silicon Nanowires and Optical Stimulation for Investigations of Intra- and Intercellular Electrical Coupling

Myofibroblasts can spontaneously internalize silicon nanowires (SiNWs), making them an attractive target for bioelectronic applications. These cell-silicon hybrids offer leadless optical modulation capabilities with minimal perturbation to normal cell behavior. The optical capabilities are obtained by the photothermal and photoelectric properties of SiNWs. These hybrids can be harvested using standard tissue culture techniques and then applied to different biological scenarios. We demonstrate here how these hybrids can be used to study the electrical coupling of cardiac cells and compare how myofibroblasts couple to one another or to cardiomyocytes. This process can be accomplished without special equipment beyond a fluorescent microscope with coupled laser line. Also shown is the use of a custom-built MATLAB routine that allows the quantification of calcium propagation within and between the different cells in the culture. Myofibroblasts are shown to have a slower electrical response than that of cardiomyocytes. Moreover, the myofibroblast intercellular propagation shows slightly slower, though comparable velocities to their intracellular velocities, suggesting passive propagation through gap junctions or nanotubes. This technique is highly adaptable and can be easily applied to other cellular arenas, for in vitro as well as in vivo or ex vivo investigations.

This protocol describes the use of silicon nanowires for intracellular optical bio-modulation of cell in a simple and easy to perform method. The technique is highly adaptable to diverse cell types and can be used for in vitro as well as in vivo applications.

ננו-חוטי סיליקון וגירוי אופטי לחקירות של צימוד חשמלי פנים-תאי

Myofibroblasts can spontaneously internalize silicon nanowires (SiNWs), making them an attractive target for bioelectronic applications. These ...

Isolation of Microvascular Endothelial Tubes from Mouse Resistance Arteries

The control of blood flow by the resistance vasculature regulates the supply of oxygen and nutrients concomitant with the removal of metabolic by-products, as exemplified by exercising skeletal muscle. Endothelial cells (ECs) line the intima of all resistance vessels and serve a key role in controlling diameter (e.g.&#160;endothelium-dependent vasodilation) and, thereby, the magnitude and distribution of tissue blood flow. The regulation of vascular resistance by ECs is effected by intracellular Ca2+ signaling, which leads to production of diffusible autacoids (e.g.&#160;nitric oxide and arachidonic acid metabolites)1-3 and hyperpolarization4,5 that elicit smooth muscle cell relaxation. Thus understanding the dynamics of endothelial Ca2+ signaling is a key step towards understanding mechanisms governing blood flow control. Isolating endothelial tubes eliminates confounding variables associated with blood in the vessel lumen and with surrounding smooth muscle cells and perivascular nerves, which otherwise influence EC structure and function. Here we present the isolation of endothelial tubes from the superior epigastric artery (SEA) using a protocol optimized for this vessel.
To isolate endothelial tubes from an anesthetized mouse, the SEA is ligated in situ to maintain blood within the vessel lumen (to facilitate visualizing it during dissection), and the entire sheet of abdominal muscle is excised. The SEA is dissected free from surrounding skeletal muscle fibers and connective tissue, blood is flushed from the lumen, and mild enzymatic digestion is performed to enable removal of adventitia, nerves and smooth muscle cells using gentle trituration. These freshly-isolated preparations of intact endothelium retain their native morphology, with individual ECs remaining functionally coupled to one another, able to transfer chemical and electrical signals intercellularly through gap junctions6,7. In addition to providing new insight into calcium signaling and membrane biophysics, these preparations enable molecular studies of gene expression and protein localization within native microvascular endothelium.

We present a preparation for visualizing and manipulating calcium signaling in native, intact microvascular endothelium. Endothelial tubes freshly isolated from mouse resistance arteries supplying skeletal muscle retain in vivo morphology and dynamic signaling within and between neighboring cells. Endothelial tubes can be prepared from microvessels of other tissues and organs.

בידוד של כלי הדם האנדותל צינורות מעורקי עכבר התנגדות

The control of blood flow by the resistance vasculature regulates the supply of oxygen and nutrients concomitant with the removal of metabolic ...

Development of a Noninvasive, Laser-Assisted Experimental Model of Corneal Endothelial Cell Loss

Nd:YAG lasers have been used to perform noninvasive intraocular surgery, such as capsulotomy for several decades now. The incisive effect relies on the optical breakdown at the laser focus. Acoustic shock waves and cavitation bubbles are generated, causing tissue rupture. Bubble sizes and pressure amplitudes vary with pulse energy and position of the focal point. In this study, enucleated porcine eyes were positioned in front of a commercially available Nd:YAG laser. Variable pulse energies as well as different positions of the focal spots posterior to the cornea were tested. Resulting lesions were evaluated by two-photon microscopy and histology to determine the best parameters for an exclusive detachment of corneal endothelial cells (CEC) with minimum collateral damage. The advantages of this method are the precise ablation of CEC, reduced collateral damage, and above all, the non-contact treatment.

Here, we present a protocol to detach corneal endothelial cells (CEC) from Descemet&#8217;s membrane (DM) using a neodymium:YAG (Nd:YAG) laser as an ex vivo disease model for bullous keratopathy (BK).

פיתוח של מודל פולשני, בסיוע לייזר של הקרנית הפסד של תא אנדותל

Nd:YAG lasers have been used to perform noninvasive intraocular surgery, such as capsulotomy for several decades now. The incisive effect relies on the ...

Medicine

A Cardiac Microphysiological System for Studying Ca2+ Propagation via Non-genetic Optical Stimulation

In vitro cardiac microphysiological models are highly reliable for scientific research, drug development, and medical applications. Although widely accepted by the scientific community, these systems are still limited in longevity due to the absence of non-invasive stimulation techniques. Phototransducers provide an efficient stimulation method, offering a wireless approach with high temporal and spatial resolution while minimizing invasiveness in stimulation processes. In this manuscript, we present a fully optical method for stimulating and detecting the activity of an in vitro cardiac microphysiological model. Specifically, we fabricated engineered laminar anisotropic tissues by seeding human-induced pluripotent stem cell-derived cardiomyocytes (hiPSC-CMs) generated in a 3D bioreactor suspension culture. We employed a phototransducer, an amphiphilic azobenzene derivative, named Ziapin2, for stimulation and a Ca2+ dye (X-Rhod 1) for monitoring the system&#39;s response. The results demonstrate that Ziapin2 can photomodulate Ca2+ responses in the employed system without compromising tissue integrity, viability, or behavior. Furthermore, we showed that the light-based stimulation approach offers a similar resolution compared to electrical stimulation, the current gold standard. Overall, this protocol opens promising perspectives for the application of Ziapin2 and material-based photostimulation in cardiac research.

Using light to control cardiac cells and tissue enables non-contact stimulation, thereby preserving the natural state and function of the cells, making it a valuable approach for both basic research and therapeutic applications.

מערכת מיקרופיזיולוגית לבבית לחקר התפשטות Ca2+ באמצעות גירוי אופטי לא גנטי

In vitro cardiac microphysiological models are highly reliable for scientific research, drug development, and medical applications. Although widely ...

Voltage and Calcium Dual Channel Optical Mapping of Cultured HL-1 Atrial Myocyte Monolayer

Optical mapping has proven to be a valuable technique to detect cardiac electrical activity on both intact ex vivo hearts and in cultured myocyte monolayers. HL-1 cells have been widely used as a 2-Dimensional cellular model for studying diverse aspects of cardiac physiology. However, it has been a great challenge to optically map calcium (Ca) transients and action potentials simultaneously from the same field of view in a cultured HL-1 atrial cell monolayer. This is because special handling and care is required to prepare healthy cells that can be electrically captured and optically mapped. Therefore, we have developed an optimal working protocol for dual channel optical mapping. In this manuscript, we have described in detail how to perform the dual channel optical mapping experiment. This protocol is a useful tool to enhance the understanding of action potential propagation and Ca kinetics in arrhythmia development.

This article describes the technique used to perform dual channel optical mapping in cultured HL-1 atrial cell monolayers. This unique protocol allows the simultaneous visualization of both calcium (Ca) and voltage (Vm) activity in the same area for the detailed detection and analysis of electrophysiological properties of culture monolayers.

מתח וסידן ערוץ כפול אופטי מיפוי של תרבית HL-1 פרוזדורים Myocyte חד שכבתי

Optical mapping has proven to be a valuable technique to detect cardiac electrical activity on both intact ex vivo hearts and in cultured myocyte ...

Multifunctional, Micropipette-based Method for Incorporation And Stimulation of Bacterial Mechanosensitive Ion Channels in Droplet Interface Bilayers

MscL, a large conductance mechanosensitive channel (MSC), is a ubiquitous osmolyte release valve that helps bacteria survive abrupt hypo-osmotic shocks. It has been discovered and rigorously studied using the patch-clamp technique for almost three decades. Its basic role of translating tension applied to the cell membrane into permeability response makes it a strong candidate to function as a mechanoelectrical transducer in artificial membrane-based biomolecular devices. Serving as building blocks to such devices, droplet interface bilayers (DIBs) can be used as a new platform for the incorporation and stimulation of MscL channels. Here, we describe a micropipette-based method to form DIBs and measure the activity of the incorporated MscL channels. This method consists of lipid-encased aqueous droplets anchored to the tips of two opposing (coaxially positioned) borosilicate glass micropipettes. When droplets are brought into contact, a lipid bilayer interface is formed. This technique offers control over the chemical composition and the size of each droplet, as well as the dimensions of the bilayer interface. Having one of the micropipettes attached to a harmonic piezoelectric actuator provides the ability to deliver a desired oscillatory stimulus. Through analysis of the shapes of the droplets during deformation, the tension created at the interface can be estimated. Using this technique, the first activity of MscL channels in a DIB system is reported. Besides MS channels, activities of other types of channels can be studied using this method, proving the multi-functionality of this platform. The method presented here enables the measurement of fundamental membrane properties, provides a greater control over the formation of symmetric and asymmetric membranes, and is an alternative way to stimulate and study mechanosensitive channels.

Bacterial mechanosensitive channels can be used as mechanoelectrical transducers in biomolecular devices. Droplet interface bilayers (DIBs), cell-inspired building blocks to such devices, represent new platforms to incorporate and stimulate mechanosensitive channels. Here, we demonstrate a new micropipette-based method of forming DIBs, allowing the study of mechanosensitive channels under mechanical stimulation.

רב תכליתיים, Micropipette מבוסס שיטה להתאגדות וגירוי של ערוצים בקטריאלי Mechanosensitive יון בbilayers ממשק אגל

MscL, a large conductance mechanosensitive channel (MSC), is a ubiquitous osmolyte release valve that helps bacteria survive abrupt hypo-osmotic shocks. ...

הערכת פעילות הסידן בשכבת תאי גנגליון ברשתית

Calcium Imaging In Electrically Stimulated Flat-Mounted Retinas

Retinal dystrophies are a leading cause of blindness worldwide. Extensive efforts are underway to develop advanced retinal prostheses that can bypass the impaired light-sensing photoreceptor cells in the degenerated retina, aiming to partially restore vision by inducing visual percepts. One common avenue of investigation involves the design and production of implantable devices with a flexible physical structure, housing a high number of electrodes. This enables the efficient and precise generation of visual percepts. However, with each technological advancement, there arises a need for a reliable and manageable ex vivo method to verify the functionality of the device before progressing to in vivo experiments, where factors beyond the device's performance come into play. This article presents a comprehensive protocol for studying calcium activity in the retinal ganglion cell layer (GCL) following electrical stimulation. Specifically, the following steps are outlined: (1) fluorescently labeling the rat retina using genetically encoded calcium indicators, (2) capturing the fluorescence signal using an inverted fluorescence microscope while applying distinct patterns of electrical stimulation, and (3) extracting and analyzing the calcium traces from individual cells within the GCL. By following this procedure, researchers can efficiently test new stimulation protocols prior to conducting in vivo experiments.

Author Spotlight: גישה חדשנית לגירוי חשמלי עצבי באמצעות הדמיית סידן 

Retinal prostheses have the ability to generate visual perceptions. To advance the development of new prostheses, ex vivo methods are needed to test devices before implantation. This article provides a comprehensive protocol for studying calcium activity in the retinal ganglion cell layer when subjected to electrical stimulation.

הדמיית סידן ברשתית שטוחה עם גירוי חשמלי

Retinal dystrophies are a leading cause of blindness worldwide. Extensive efforts are underway to develop advanced retinal prostheses that can bypass the ...

הרבייה מכאנית מושרה גירוי סיד גל בmonolayers הסלולרי: דוגמה לתאי אנדותל קרני שור

Summary

Explore More Videos

Chapters in this video

במבחנה מודלים Vivo ללמוד קרנית האנדותל-mesenchymal מעבר

צמיחת הקרנית של האדם והכבשים שכבות של תאי-על ביומטריה

ננו-חוטי סיליקון וגירוי אופטי לחקירות של צימוד חשמלי פנים-תאי

בידוד של כלי הדם האנדותל צינורות מעורקי עכבר התנגדות

פיתוח של מודל פולשני, בסיוע לייזר של הקרנית הפסד של תא אנדותל

מערכת מיקרופיזיולוגית לבבית לחקר התפשטות Ca²⁺ באמצעות גירוי אופטי לא גנטי

מתח וסידן ערוץ כפול אופטי מיפוי של תרבית HL-1 פרוזדורים Myocyte חד שכבתי

רב תכליתיים, Micropipette מבוסס שיטה להתאגדות וגירוי של ערוצים בקטריאלי Mechanosensitive יון בbilayers ממשק אגל

הדמיית סידן ברשתית שטוחה עם גירוי חשמלי

הדמיית סידן ברשתית שטוחה עם גירוי חשמלי