The authors would like to acknowledge Natalie Doude and David Westerway (University of Alberta) for providing us Sho cDNA, Christophe Chevalier (INRA) for plasmid construction, Michel Br&#233;mont (INRA) for providing us BL21Sol bacteria; Christine Longin (INRA) for TEM assistance and Edith Pajot-Augy (INRA) for comments and proofreading.

Plazmid ve Shadoo İfade 1. Üretim Not: Gen kodlayan sıçangil Shadoo protein (Shadoo 25-122), ekspresyon vektörü pET-28 11 içine alt klonlandı. Bu klon, E. dönüştürüldü Daha önce açıklandığı gibi, 11 coli, bir N-ucu heksahistidin etiketi, (HHHHHHHHHHSSGHIDDDDKHMKGGRGGARGSARGVRGGARGASRVRVRP APRYGSSLRVAAAGAAAGAAAGVAAGLATGSGWRRTSGPGELGLEDDENGAMGGNGTDRGVYSYWAWTSG) ile Shadoo proteinini ifade etmek için, bir bakteri suşunun SoluBL21. Plazmid yazarlarından talep edilebilir. Amino asit dizisinden hesaplanan Shadoo molekül ağırlığı 12,243.2 Da&#39;dır. Not: Bir laminal akış kaputu altında veya yakınında Bunsen aleve bakteriler ile tüm manipülasyonlar gerçekleştirin. <ol><li> Standart ısı şok protokolü kullanarak, pET-28-His 6 -Shadoo plazmid ile yetkili SoluBL21 bakteri Transform. Plazmid 1 5 ul bu karışıma için (tipik olarak 10 pg ile 100Bir tüp içinde bakteri 50 ul halinde ng). 45 saniye için 42 ° C &#39;de bir ısı şoku gerçekleştirin. </li><li> Kültür 40 mg / ml kanamisin (Şekil 1B) ile takviye edilmiş Luria-Bertani ortamında 0.5-0.7 arasında bir 600 kadar 37 ° C &#39;de bakteri dönüştürdü. </li><li> Kültür, 240 ug / ml izopropil-β-D-tiogalaktopiranosid, ITPG ekleyerek Shadoo sentezleme O / N neden. 37 ° C&#39;de 150 rpm&#39;de çalkalanarak kültür bakterileri. Not: Genellikle, bakteri kültürü 600 3 O / N ulaşır. Not: Transforme bakteriler sonraki protein üretimi için -80 ° C &#39;de muhafaza edilebilir. Bunun için, bakteri kültürü kısma 10% -50% (v / v) steril gliserol ekleyin ve -80 ° C&#39;de dondurmak. </li></ol><img alt="figür 1" src="/files/ftp_upload/53432/53432fig1.jpg" /> Shadoo ifade Shadoo sentezleme konstruktu, bakteri dönüşüm ve indüksiyon Şekil 1, Şema (aşama 1 olarak tarif edilmiştir). </strong&gt; (A) Shadoo için ekspresyon yapısı, bir protein, Nt N-terminalinde kaynaşmış bir hekzahistidin etiketi kodlar. Düzeni Shadoo proteini C-ucu (Ct), ardından bazik arginin / glisin tekrarları (yeşil silindir), bir hidrofobik domain (HD), ve tek bir N-glikosilasyon sitesi (CHO) içerdiğini göstermektedir. (B), pET-28-His 6 -Shadoo plazmid 42 ° C&#39;de 45 saniye boyunca ısı şoku ile SoluBL21 bakterilerin içine transforme edilir. Dönüştürülen bakteriler, seçici agar / ml kanamisin ihtiva eden 40 ug ekilir. Levhasından tek bir koloni, bir 1,000-3,000 ml&#39;lik bir çalkalama şişesinde bir kültürü inoküle etmek için kullanılır. Rekombinant proteinin ifadesi 1 mM IPTG ile uyarılır. <a href="https://www.jove.com/files/ftp_upload/53432/53432fig1highres.jpg" target="_blank">Bu rakamın büyük halini görmek için lütfen buraya tıklayınız.</a> Düşük Basınçlı Sıvı Kromatografisi Shadoo Protein 2. saflaştırma (LPLC) <ol><li> Hücre parçalama ve deetme gövdelerinin hazırlık <ol><li> Bakteri süspansiyonu toplayın ve santrifüj tüpleri (Şekil 2) içine aktarın. </li><li> 4 ° C&#39;de 20 dakika boyunca 2500 x g&#39;de Spin. Dekantasyon ve hücre kültürü 500 ml elde edilen her bir pelet için tekrar süspansiyon peletler (anti-proteaz kokteyli ile 50 mM Tris, 10 mM EDTA, pH 8) 15 ml tampon maddesi içinde süpernatantı. Not: Tekrar süspansiyon haline getirilen topaklar dondurulmuş ve birkaç gün boyunca -20 ° C&#39;de saklanabilir. Donma bakteri hücreleri lizisini kolaylaştırır. </li><li> SDS-PAGE analizi ve Coomassie boyama Ham bakteri pelet kullanılarak rekombinant proteinin aşırı ekspresyonunu kontrol edin. <ol><li> Bunun için, bakteri kültürü santrifüj 1 mi pelet hücreleri. 5 dakika boyunca 100 ° C &#39;de 100 ul Laemmli denatürasyon: pelet çözeltisi (277,8 mM Tris-HCl, pH 6.8,% 4.4 SDS,% 44.4 w / v gliserol,% 0.02 bromofenol) ile ısıtılır. </li><li> % 12 akrilamid jeline Yük örnek 10 ul, çalışma SDS-PAGE ve visualize Coomassie boyaması proteinleri ayrıldı. </li></ol></li><li> ) 2.1.2 tamamen yeniden süspanse pelet% 0.5 nihai konsantrasyona kadar Triton X-100 ekleyin. </li><li> 30 dakika boyunca 37 ° C&#39;de su banyosu içinde süspansiyon inkübe edin. </li><li> Bakteriyel hücreler lize edildi, buz soğukluğunda su içinde 6-12 mikron tepe-tepe genlik 5 dakika boyunca bir süspansiyon sonikasyon. </li><li> Aktarım, temiz 50 ml&#39;lik santrifüj tüpleri içine süspansiyon sonike edilmiştir. </li><li> 4 ° C&#39;de 15 dakika boyunca 15.000 x g&#39;de santrifüje tüpleri. </li><li> Boşaltma yoluyla Süpernatantı ve tüp başına bağlanma tamponu (20 mM Tris-HCl tamponu, pH 7,4, 0,5 M NaCl, 8 M Üre, 5 mM İmidazol) kullanılarak, 5 ml ilave edin. </li><li> Dönen tekerlek O / N yerleştirin tüpleri tamamen cisimcikler proteinleri tekrar süspansiyon. </li></ol><img alt="Şekil 2," src="/files/ftp_upload/53432/53432fig2.jpg" /> Içerme arınma Şekil 2. ŞemaShadoo eksprese organları (adım 2.1 de tarif edildiği gibi). Transforme bakteriler santrifüje tabi tutularak toplanmış ve liziz tamponunda yeniden süspanse edilir. Süspansiyon 30 dakika için 37 ° C sıcaklıkta inkübe edilir ve daha sonra mekanik olarak bakteriyel hücreler kırmak için ses dalgalarına tabi tutulur. Sonikasyon örnek ısınmasını önlemek için buz üzerinde yapılır. Kırık hücreler santrifüj ile toplanır ve inklüzyon cisimciklerinin proteinleri çözünür 8 M üre ihtiva eden bir tampon içinde tekrar süspanse edilir. <a href="https://www.jove.com/files/ftp_upload/53432/53432fig2highres.jpg" target="_blank">Bu rakamın büyük halini görmek için lütfen buraya tıklayınız.</a> </li><li> Ni2 + -affinity kromatografisi Not: Kromatografi 5 mi Sefaroz kenetleme kolonu (Şekil 3A), bir Ni 2+ -yüklü kullanılarak FPLC Sistemi üzerinde gerçekleştirilmiştir. Bütün çözeltiler 1 ml / dakika bir akış oranı ile sütun üzerine yüklenir. <ol><li> Şarj etmek için Sepharose sütuna 0.2 M Niso 4 su çözeltisi 10 ml enjekteNi 2+ -ions ile. </li><li> Imidazol düşük konsantrasyonda (20 mM Tris-HCl tamponu, pH 7,4, 0,5 M NaCl, 8 M Üre, 5 mM İmidazol) ihtiva eden bağlama tamponu 30-50 ml enjekte edilmesi ile Ni2 + -ions görevli sütun dengelenmesi. </li><li> 50 ml&#39;lik enjeksiyon döngüsü ile üre çözünebilir proteinleri yükleyin. </li><li> İyice bağlanmamış proteinin maksimum çıkarmak için 10 mi, düşük imidazol bağlanma tamponu (20 mM Tris-HCl tamponu, pH 7.4, 0.5 M NaCI, 8 M Üre, 5 mM İmidazol) ile yıkanması sureti ile akış geçiş kısmını kurtarma kolondan. </li><li> (MM Tris-HCI, pH 7.4, 0.5 M NaCl, 8 M üre, 80 mM imidazol 20) spesifik olmayan Sütuna bağlanmış proteinler elüt edilmesi için yıkama tamponu 50-100 ml sütun yıkayın. </li><li> 20 mM Tris-HCl, pH 7.4, 0.5 M NaCl, 8 M üre ihtiva eden tampon maddesi içinde 80-800 mM imidazol 15 dakika lineer gradyan uygulanır. Degrade uygulama sırasında 1 ml kesirler toplayın. Not: His-etiketli proteinleri wit elüte edilir(a rakip olarak kullanılabilir) imidazol ihtiva eden tampon ha gradyanı. </li><li> (2.1.3.1 bakınız) Her bir fraksiyonun bir 8 ul tablet alın ve 4 ul 4x Laemmli denatürasyon çözeltisi ilave edilir. 5 dakika boyunca 100 ° C&#39;de ısı çözümler. </li><li> Yük Coomassie boyama ile protein boyut işaretleyici 10 ul% 12 akrilamid jeline her numunenin 10 ul, çalışma SDS-PAGE ve görselleştirmek ayrılan proteinler. Not: hesaplanan Shadoo molekül ağırlığı, amino asit sekansı 12,243.2 Da&#39;dır oluştururlar. </li><li> Havuz Shadoo içeren tüm fraksiyonlar. </li></ol><img alt="Şekil 3," src="/files/ftp_upload/53432/53432fig3.jpg" /> (Adımları 2.2-2.4 de tarif edildiği gibi) 3. saflaştırma prosedürü Şekil. (A) Ni2 + -ions polihistidin ile işaretlenmiş olan proteinlerin seçici olarak temizlenmesini mümkün kılmaktadır histidin artığının koordine edilebilir. İmidazol ile, protein elüt edilmesi için kullanılmaktadırNi2 + -iyon ile koordine ve bağlı proteinin yerini yeteneğidir. (B) bir ebat eksklüzyon kolonu üzerine ayrılır Sütunlu Ni 2+ üzerinde tutulan edildi değişen hidrodinamik radius proteinler. Proteinler küçük olanlar büyük elüte edilir. (C) Kullanımdan önce, Shadoo ihtiva eden fraksiyonlar bir araya toplanmış ve üre, imidazol ve tuzları yok etmek için tuzdan arındırılmıştır edilir. Kalite kontrol deneyleri SDS-PAGE / Coomassie lekeleme, Western blotlama içerir. Saflaştırılmış Shadoo dondurularak kurutulabilir. -20 ° C&#39;de saklandığında Liyofilize Shadoo ay boyunca stabildir. <a href="https://www.jove.com/files/ftp_upload/53432/53432fig3highres.jpg" target="_blank">Bu rakamın büyük halini görmek için lütfen buraya tıklayınız.</a> </li><li> Ebat eksklüzyon kromatografı Not: İkinci bir saflaştırma adımı diğer proteinler, birinci saflaştırma aşaması sırasında birlikte elüt gelen Shadoo proteini ayıran boyut dışlama kromatografisi oluşur(Şekil 3B). <ol><li> 1,5 ml / dakika akış hızında 20 mM Tris-HCI tamponu, pH 7.4, 0.5 M NaCI, 8 M Üre, 250 ml enjekte edilerek toplam yatak hacmi 120 ml Superdex sütunu dengelenmesi. </li><li> Dengelenmiş sütun üzerinde 2.2.9 den Shadoo ihtiva eden yükleme Bir araya toplanan fraksiyonlar. Yukarıda bahsedilen tampon maddenin sürekli bir akımının meydana getirilmesi üzerine 40 ml sütun boşluk hacmi sonra, 1 ml&#39;lik fraksiyonların toplayın. </li><li> Her bir fraksiyonun bir 10 ul tablet alın ve fraksiyonlar Shadoo içeren olduğunu öğrenmek için yukarıda tarif edildiği gibi SDS-PAGE analizi ve Coomassie boyama yapar. </li><li> Shadoo ihtiva eden fraksiyonlar Havuz. </li></ol></li><li> Tuzdan arındırma Not: tuz giderme işlemi daha biyofiziksel ve biyokimyasal çalışmalar (Şekil 3C) için uygun olan bir tampon maddesi içinde rekombinant Shadoo proteini elde etmek üzere tuzlar, imidazol ve üre kaldırır. Aynı sonuç tampon maddesine karşı diyaliz örnekleri ile elde edilebilir. <ol><li> 150 ml 53 ml &#39;lik bir tuz giderme kolonu dengeye/ dakika, 5 ml akış hızında 10 mM amonyum asetat tamponu, pH 5, arasında. </li><li> Yük kolonu üzerinde Shadoo fraksiyonlar havuzlandı. Amonyum asetat tamponu enjeksiyonu üzerine elle UV detektörü çıkışında 280 nm&#39;de sinyal bir artış olduğunu göstermektedir fraksiyonlarım toplamak. </li><li> -Freeze kurutmak tuzu giderilmiş Shadoo ve -20 ° C&#39;de saklayın. </li><li> Uygun bir tampon maddesi içinde liyofilize Shadoo, örneğin 10 mM sodyum asetat tamponu, pH 5 içinde çözündürülür, kullanımdan önce. Not: polihistidin etiketi enterokinaz ile temizlenebilir. </li></ol></li></ol> Fizyolojik pH&#39;da Amiloid fibrillerin içine Shadoo in vitro bir araya 3. Not: kendiliğinden Shadoo Protein topakları gece boyunca pH ≥ 7 11 de fibriller oluşturur. <img alt="Şekil 4," src="/files/ftp_upload/53432/53432fig4.jpg" /> Shadoo amiloid fibrillere refolding Şekil 4. Programı (descri olarakÇalkalarken bir asidik çözeltinin pH ≥ 7 tampon içinde çözüldüğünde Adım 3&#39;te yatak). Saflaştırılmış Shadoo kendiliğinden amiloid fibrillere dönüştürür Shadoo 1 M Gdn-HCl ile kuluçkaya yatırıldıktan sonra amiloid fibrillere dönüştürür. Kalite kontrol deneyleri, elektronik mikroskop ve ThT boyama bulunmaktadır. <a href="https://www.jove.com/files/ftp_upload/53432/53432fig4highres.jpg" target="_blank">Bu rakamın büyük halini görmek için lütfen buraya tıklayınız.</a> <ol><li> 20 mM Tris-HCI tampon maddesi, pH 7.4 içinde 2 uM&#39;lik bir son konsantrasyona Shadoo seyreltilir. 280 nm &#39;de çözeltinin optik yoğunluğu ölçmek ve 20,970 arasında Shadoo amino asit bileşimi çıkarsanan sönüm katsayısı kullanarak konsantrasyonu ölçümü. </li><li> Amiloid yapılarına (Şekil 4) kendiliğinden protein dönüşümü sağlamak için, bir kaç hafta boyunca 4 ° C &#39;de konik bir plastik tüp içinde solüsyon 500 ul inkübe edin. </li><li> Taze nihai conce, T (ThT), Tioflavin hazırlanabilir ekleShadoo solüsyonu, 100 ul bölüntüde 10 uM ntration. Oda sıcaklığında 5 dakika boyunca çözelti inkübe edin. Amiloid yapılarına 17 varlığını doğrulamak için 435 nm&#39;lik bir eksitasyon dalga boyu kullanılarak 460 520 nm floresan emisyon ölçün. </li></ol> Asidik pH&#39;larda Amiloid fibrillerin için Shadoo in vitro bir araya 4. <ol><li> 2 uM nihai konsantrasyona kadar 1 M GdnHCl, 20 mM Na-asetat tampon, pH 5 Shadoo seyreltilir. </li><li> 3-7 gün boyunca, 37 ° C&#39;de sürekli çalkalanarak konik bir tüp içinde, bu çözeltinin 500 ul inkübe edin. </li><li> 3.3 olarak çözeltisinin bir alikotuna THT ekleyerek Amiloid fibrillerin varlığını kontrol edin. </li><li> Shadoo amiloid fibrillerine arındırmak için, 10 mM Na-asetat tamponu, pH 5.0 karşı elde edilen süspansiyonun Dialyze. </li><li> 4 ° C&#39;de saflaştırılmış fibriller saklayın. </li></ol><img alt="Şekil 5," src="/files/ftp_upload/53432/53432fig5.jpg"/&gt; Ni2 + elüt Şekil 5. Örnek sonuçlanır. Protein fraksiyonlar kenetleme kolonu (A) ve boyut dışlama kolonu (B), SDS-PAGE ve Coomassie boyama ile analiz edilmiştir -yüklü. Saflaştırılmış Shadoo tanımlanması SPRN anti-Shadoo antikoru (C) kullanılarak değerlendirildi. <a href="https://www.jove.com/files/ftp_upload/53432/53432fig5large.jpg" target="_blank">Bu rakamın büyük halini görmek için lütfen buraya tıklayınız.</a>

<ol>
	<li>Biasini, E., Turnbaugh, J. A., Unterberger, U., Harris, D. A. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Prion+protein+at+the+crossroads+of+physiology+and+disease.">Prion protein at the crossroads of physiology and disease.</a> Trends in Neurosciences. 35, 92-103 (2012).</li><li>Colby, D. W., Prusiner, S. B. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=De+novo+generation+of+prion+strains.">De novo generation of prion strains.</a> Nature Reviews. Microbiology. 9, 771-777 (2011).</li><li>Chiti, F., Dobson, C. M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Protein+misfolding,+functional+amyloid,+and+human+disease.">Protein misfolding, functional amyloid, and human disease.</a> Annual Review of Biochemistry. 75, 333-366 (2006).</li><li>Nelson, R., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Structure+of+the+cross-beta+spine+of+amyloid-like+fibrils.">Structure of the cross-beta spine of amyloid-like fibrils.</a> Nature. 435, 773-778 (2005).</li><li>Murphy, R. M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Kinetics+of+amyloid+formation+and+membrane+interaction+with+amyloidogenic+proteins.">Kinetics of amyloid formation and membrane interaction with amyloidogenic proteins.</a> Biochimica et Biophysica Acta. 1768, 1923-1934 (2007).</li><li>Steunou, S., Chich, J. F., Rezaei, H., Vidic, J. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Biosensing+of+lipid-prion+interactions:+insights+on+charge+effect,+Cu(II)-ions+binding+and+prion+oligomerization.">Biosensing of lipid-prion interactions: insights on charge effect, Cu(II)-ions binding and prion oligomerization.</a> Biosensors &amp; Bioelectronics. 26, 1399-1406 (2010).</li><li>Watts, J. C., Westaway, D. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+prion+protein+family:+diversity,+rivalry,+and+dysfunction.">The prion protein family: diversity, rivalry, and dysfunction.</a> Biochimica et Biophysica Acta. 1772, 654-672 (2007).</li><li>Westaway, D., Daude, N., Wohlgemuth, S., Harrison, P. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+PrP-like+proteins+Shadoo+and+Doppel.">The PrP-like proteins Shadoo and Doppel.</a> Topics in Current Chemistry. 305, 225-256 (2011).</li><li>Baillod, P., Garrec, J., Tavernelli, I., Rothlisberger, U. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Prion+versus+doppel+protein+misfolding:+new+insights+from+replica-exchange+molecular+dynamics+simulations.">Prion versus doppel protein misfolding: new insights from replica-exchange molecular dynamics simulations.</a> Biochemistry. 52, 8518-8526 (2013).</li><li>Daude, N., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Wild-type+Shadoo+proteins+convert+to+amyloid-like+forms+under+native+conditions.">Wild-type Shadoo proteins convert to amyloid-like forms under native conditions.</a> Journal of Neurochemistry. 113, 92-104 (2010).</li><li>Li, Q., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Shadoo+binds+lipid+membranes+and+undergoes+aggregation+and+fibrillization.">Shadoo binds lipid membranes and undergoes aggregation and fibrillization.</a> Biochemical and Biophysical Research Communications. 438, 519-525 (2013).</li><li>Watts, J. C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+CNS+glycoprotein+Shadoo+has+PrP(C)-like+protective+properties+and+displays+reduced+levels+in+prion+infections.">The CNS glycoprotein Shadoo has PrP(C)-like protective properties and displays reduced levels in prion infections.</a> The EMBO Journal. 26, 4038-4050 (2007).</li><li>Watts, J. C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Protease-resistant+prions+selectively+decrease+Shadoo+protein.">Protease-resistant prions selectively decrease Shadoo protein.</a> PLoS Pathogens. 7, e1002382 (2011).</li><li>Westaway, D., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Down-regulation+of+Shadoo+in+prion+infections+traces+a+pre-clinical+event+inversely+related+to+PrP(Sc)+accumulation.">Down-regulation of Shadoo in prion infections traces a pre-clinical event inversely related to PrP(Sc) accumulation.</a> PLoS Pathogens. 7, e1002391 (2011).</li><li>Chevalier, C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=PB1-F2+influenza+A+virus+protein+adopts+a+beta-sheet+conformation+and+forms+amyloid+fibers+in+membrane+environments.">PB1-F2 influenza A virus protein adopts a beta-sheet conformation and forms amyloid fibers in membrane environments.</a> The Journal of Biological Chemistry. 285, 13233-13243 (2010).</li><li>Tarus, B., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Oligomerization+paths+of+the+nucleoprotein+of+influenza+A+virus.">Oligomerization paths of the nucleoprotein of influenza A virus.</a> Biochimie. 94, 776-785 (2012).</li><li>Biancalana, M., Koide, S. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Molecular+mechanism+of+Thioflavin-T+binding+to+amyloid+fibrils.">Molecular mechanism of Thioflavin-T binding to amyloid fibrils.</a> Biochimica et Biophysica Acta. 1804, 1405-1412 (2010).</li><li>Minic, J., Sautel, M., Salesse, R., Pajot-Augy, E. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Yeast+system+as+a+screening+tool+for+pharmacological+assessment+of+g+protein+coupled+receptors.">Yeast system as a screening tool for pharmacological assessment of g protein coupled receptors.</a> Current Medicinal Chemistry. 12, 961-969 (2005).</li><li>Schein, C. H. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=A+cool+way+to+make+proteins.">A cool way to make proteins.</a> Nature Biotechnology. 22, 826-827 (2004).</li><li>Sorensen, H. P., Mortensen, K. K. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Advanced+genetic+strategies+for+recombinant+protein+expression+in+Escherichia+coli.">Advanced genetic strategies for recombinant protein expression in Escherichia coli.</a> Journal of Biotechnology. 115, 113-128 (2005).</li><li>Zhang, J., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Disruption+of+glycosylation+enhances+ubiquitin-mediated+proteasomal+degradation+of+Shadoo+in+Scrapie-infected+rodents+and+cultured+cells.">Disruption of glycosylation enhances ubiquitin-mediated proteasomal degradation of Shadoo in Scrapie-infected rodents and cultured cells.</a> Molecular Neurobiology. 49, 1373-1384 (2014).</li><li>Englund, P. T. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+structure+and+biosynthesis+of+glycosyl+phosphatidylinositol+protein+anchors.">The structure and biosynthesis of glycosyl phosphatidylinositol protein anchors.</a> Annual Review of Biochemistry. 62, 121-138 (1993).</li><li>Puig, B., Altmeppen, H., Glatzel, M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+GPI-anchoring+of+PrP:+implications+in+sorting+and+pathogenesis.">The GPI-anchoring of PrP: implications in sorting and pathogenesis.</a> Prion. 8, 11-18 (2014).</li></ol>

The authors have nothing to disclose.

İfade ve rekombinant fare Shadoo proteininin büyük miktarda saflaştırılması hem de kolay ve etkin bir protokol verilmektedir. Anlatılan yöntem başarılı çözülmesini ve (O&#39;nun 6) etiketli rekombinant Shadoo proteinin saflaştırılması verir. Başlığında belirttiği gibi bu, önemli bir prokaryotik bakterinin E. olarak ifade edildiğinde E. coli katma kütlelerinin Shadoo birikir. Shadoo arıtılmadan önce, bakteri Triton X-100 içeren bir tampon içinde sonifikasyon il...

İnsanlarda koyun ve Creutzfeldt-Jakob hastalığında sığır süngersi sığır ensefalopati, skrapisini dahil prion nörodejeneratif hastalıklar, ölümcül ve çaresiz. Prion hastalıkları esas olarak çapraz β-tabaka içine α-helisler oluşan hücresel prion proteininin konformasyonel değişiklikler ile karakterize edilen 1,2 konformer amiloid zenginleştirilmiş. Çapraz β-yapılar yoğun paketlenmiş içeren ve son derece düzenli kristal benzeri β-yaprak hidrojen bağları 3,4 ile stabilize. Prion amiloidleri işe bir şablon sağlamak ve bir monomerik protein birimi dönüştürme büyüyen kenarında β-ipliklerini nedeniyle kendini kopyalayan yapabilirsiniz. &quot;Protein sadece&quot; hipotezine göre, prion proteininin amiloid konformer tek bulaşıcı ajandır. Bununla birlikte, başka bir biyomoleküllerin prion bozukluklarına gerekli olduğu önerilmiştir. Örneğin, hücre zarları, bir yer burada conversi olduğu düşünülmektediryer alır ve bazı negatif yüklü lipidler dönüştürme işlemi, 5,6 artırmak için gösterilmiştir. Buna ek olarak, bazı proteinler de prion patolojilerinde dahil olabilir. Doppel ve Shadoo 7,8: Spesifik olarak, prion proteini ailesinin iki diğer üyeleri vardır. Doppel di-sülfit köprüler ile stabilize nispeten rijit bir yapıya sahiptir ve Amiloid fibrillerin 9 kendi kendine polimerleşme ve agrega başarısız olur. Bunun aksine, prion proteinine benzer Shadoo amiloid fibril yapılarına bir β-tabaka zenginleştirilmiş bir yapı ve kendi kendine ilişkilendirmek alabilir. Bu Shadoo doğal koşullar altında, veya negatif yüklü membranlar 10,11 bağlanması üzerine liflenme denetlenebilir olduğu gösterilmiştir. Amiloid benzeri lif haline Shadoo dönüştürülmesi patolojileri ile ilişkili olabilir. Nitekim, amiloid benzeri yapılar hastalığa neden olan mekanizmalar tam olarak anlaşılamamıştır. Shadoo bir hidrofobik domain (HD) ve tandem Arg / Gly dizisi yer almaktadır içindeki t tekrarlarPrion proteininin (Şekil 1A) N-terminal parçası o. Prion proteininin N-terminal parçası olarak, Shadoo yüksek pozitif yüklü ve doğal olarak yapılandırılmamış bir protein 11,12 olduğu görünür. Doğrudan prion proteininin bağlanabildiği yana Shadoo prion bozukluklarına işlevsel olarak ilişkili gibi görünmektedir. Buna ek olarak, ifade aşağı prion patoloji 13,14 sırasında düzenlenir. Ancak, prion hastalığı Shadoo rolü henüz kurulmuş değildir. Bu fare Shadoo geninin kodlama dizilimini taşıyan bir plazmit geliştirdi. Plasmid E. dönüştürmek için kullanılmış E. coli, N-terminal His 6 füzyon Shadoo proteinin üretimi için. Bu sentezleme sistemi de laboratuvarımızda kurulan ve yaygın devam eden projelerde 6,15,16 kullanılır. Shadoo ekspresyonu için önemli bir husus, E. seçimdir coli suşu. Yetkili BL21 bakteri suşu, rekombinant pro ekspresyonu için kullanılır ikenproteinlerinin Shadoo başarılı bir şekilde eksprese ve transforme SoluBL21 bakteri suşunun sadece saflaştırılmıştır. SoluBL21 yeterli E. E. coli ekspresyonu üst BL21 tespit edilebilir çözünebilir ürün elde proteinlerin üretimi için geliştirilmiş BL21 konak suşunun geliştirilmiş bir mutantıdır. SoluBL21 E. Shadoo yüksek düzeyde tanımlama E. coli katma kütlelerinin protein birikimine yol açar. Olmayan bir doğal proteinin, oldukça E. ifade edilir için genel bir özellik olarak, E. coli, bu protein, erimez içerik korları toplanma eğilimindedir. Shadoo muhtemelen farklı derecelerde katlanmış protein ile oluşturulan zenginleştirilmiş dinamik yapılara kovalent olmayan bir hidrofobik ya da iyonik etkileşimler (ya da her ikisinin bir kombinasyonu) ile toplanır. (I) denatürasyon ortamı içindeki diğer biyomoleküllerin proteinin bir seçici olarak ayrılması, ve (ii) saflaştırılmış proteinin bir renatürasyon in vitro katlanmasına kullanılarak: Sonuç olarak, en azından iki saflaştırma adımları içerirteknikleri. Shadoo seçici ayrılması 8 M üre elde edilmiştir (ya da seçenek olarak 6M Guanidin-HCl) ihtiva eden bir tampon çözeltisi içinde sağlanmıştır. (I) renatürasyon bir asidik pH çözelti içinde polimerize edilmiş Shadoo elde etmek için pH ≥ eden bir çözeltiye, 7 bir yapısal olmayan monomerik Shadoo proteini, ya da (ii) renatürasyon elde etmek üzere üre uzaklaştırılması ve protein renatürasyon çeşitli protokoller uygulanarak yapılabilir Karakteristik çapraz β-yaprak motifleri ile istikrarlı amiloid liflerinin içine.

<table>
	<tbody>
		<tr>
			<td>AKTA FPLC&#160;</td>
			<td>GE, Amersham</td>
			<td># 1363</td>
			<td></td>
		</tr>
		<tr>
			<td>HiLoad 16/60 Superdex</td>
			<td>GE Healthcare</td>
			<td>17-1069-01</td>
			<td></td>
		</tr>
		<tr>
			<td>HiTrap IMAC</td>
			<td>GE Healthcare</td>
			<td>GE17-0920-05</td>
			<td></td>
		</tr>
		<tr>
			<td>HiPrep26/10 Desalting column</td>
			<td>GE Healthcare</td>
			<td>GE17-5087-01</td>
			<td></td>
		</tr>
		<tr>
			<td>SoluBL21 Competent E. coli</td>
			<td>Genlantis</td>
			<td>C700200</td>
			<td></td>
		</tr>
		<tr>
			<td>pET-28b+</td>
			<td>Novogen</td>
			<td>69865-3</td>
			<td></td>
		</tr>
		<tr>
			<td>IPTG</td>
			<td>Sigma-Aldrich</td>
			<td>I6758</td>
			<td></td>
		</tr>
		<tr>
			<td>LB-Broth medium</td>
			<td>Sigma-Aldrich</td>
			<td>L3022</td>
			<td></td>
		</tr>
		<tr>
			<td>Eppendorf Biophotometar</td>
			<td>Eppendorf</td>
			<td>550507804</td>
			<td></td>
		</tr>
		<tr>
			<td>Trito X-100</td>
			<td>Life Technologies</td>
			<td>85111</td>
			<td></td>
		</tr>
		<tr>
			<td>NiSO4</td>
			<td>Sigma-Aldrich</td>
			<td>656895</td>
			<td></td>
		</tr>
		<tr>
			<td>EDTA</td>
			<td>Sigma-Aldrich</td>
			<td>E6758</td>
			<td></td>
		</tr>
		<tr>
			<td>Tris-HCl</td>
			<td>Sigma-Aldrich</td>
			<td>RES3098T</td>
			<td></td>
		</tr>
		<tr>
			<td>Protease Inhibitor Cocktail Tablets</td>
			<td>Roche</td>
			<td>4693116001</td>
			<td></td>
		</tr>
		<tr>
			<td>NaCl</td>
			<td>Sigma-Aldrich</td>
			<td>746398</td>
			<td></td>
		</tr>
		<tr>
			<td>Imidazol</td>
			<td>Sigma-Aldrich</td>
			<td>I5513</td>
			<td></td>
		</tr>
		<tr>
			<td>Gdn-HCl</td>
			<td>Sigma-Aldrich</td>
			<td>G4505</td>
			<td></td>
		</tr>
		<tr>
			<td>protein size marker&#160;</td>
			<td>Thermo Fisher Scientific</td>
			<td>26620</td>
			<td></td>
		</tr>
	</tbody>
</table>

purification and refolding to amyloid fibrils of (his)6-tagged recombinant shadoo protein expressed as inclusion bodies in e. coli

Escherichia coli sentezleme sistemi rekombinant ökariyotik proteinlerin üretimi için güçlü bir araçtır. Biz Shadoo prion familyasına ait bir proteini üretmek için kullanılır. Katma kütleleri tarif edildiği gibi (His) 6-etiketli rekombinant Shadoo saflaştırılması için bir kromatografik yöntem olarak ifade edilmiştir. Inklüzyon cisimcikleri, 8 M üre içinde çözülür ve iyon afinite kromatografisi gerçekleştirmek için bir Ni2 + -yüklü kolona bağlanmıştır. Bağlanmış proteinler imidazol gradyanı ile elüe edilir. Shadoo proteinini ihtiva eden fraksiyonlar bir yüksek ölçüde saflaştırılmış proteini elde etmek üzere boyut çıkarma kromatografisine tabi tutulur. Son adım saflaştırılmış Shadoo tuzlar, üre ve imidazol kaldırmak için HCl. Rekombinant Shadoo proteini prion hastalıklarda ortaya çıkan protein konformasyon bozukluklarının biyofiziksel ve biyokimyasal çalışmalar için önemli bir reaktiftir. Birçok rapor prion nörodejeneratif hastalıklar bıçak birikimi kaynaklı olduğunu gösterdile, amiloid fibrilleri emretti. Asidik ve nötr olarak amiloid fibrilleri içine Shadoo fibrillate açıklayan örnek protokoller / temel pHs sunulmuştur. Üretilmesi ve bir hızlı ve düşük maliyetli bir şekilde proteinin büyük miktarlarda üretilmesine imkan verir çünkü Shadoo, prion hastalıkları üzerinde çalışan laboratuarlarında araştırma kolaylaştırabilir liflenme ile ilgili yöntemler.

Saflaştınldı Shadoo proteinin yaklaşık 5-10 mg bakteri kültürü litresinde elde edilir. Bir iki-aşamalı saflaştırma yüksek saflıkta rekombinant Shadoo elde etmek için gereklidir. İlk adım, His-etiketli-proteinleri muhafaza eden bir Ni 2+ -yüklü kolon ile afinite kromatografisi ile gerçekleştirilir. Elüsyona uğratılan kısımlar SDS-PAGE tabi tutulur ve Coomassie Brilliant Blue (Şekil 5A) ile boyanır. Shadoo proteini ihtiva eden fraksiyonlar bir araya toplanmış ve da...

Watch this Scientific Journal Video about Purification and Refolding to Amyloid Fibrils of His6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli at JoVE.com

Purification and Refolding to Amyloid Fibrils of His6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli

A two-step chromatographic method is described for the purification of recombinant Shadoo protein expressed as inclusion bodies in Escherichia coli, as well as a protocol to fibrillate purified Shadoo into amyloid structures.

Saflaştırma ve Amiloid fibrillerin kadar yeniden katlama (His)<sub&gt; 6</sub&gt; etiketli Rekombinant Shadoo Protein Eklenmesi Organları olarak ifade<em&gt; E.coli</em

The Escherichia coli expression system is a powerful tool for the production of recombinant eukaryotic proteins. We use it to produce Shadoo, a protein ...

purification-refolding-to-amyloid-fibrils-his6-tagged-recombinant

Research

JoVE Journal

Biology

Purification and Refolding to Amyloid Fibrils of (His)6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli

14.1K Görüntüleme.  INRA. A two-step chromatographic method is described for the purification of recombinant Shadoo protein expressed as inclusion bodies in Escherichia coli, as well as a protocol to fibrillate purified Shadoo into amyloid structures. 

Video: Purification and Refolding to Amyloid Fibrils of His6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli

Staining of Proteins in Gels with Coomassie G-250 without Organic Solvent and Acetic Acid

In classical protein staining protocols using Coomassie Brilliant Blue (CBB), solutions with high contents of toxic and flammable organic solvents (Methanol, Ethanol or 2-Propanol) and acetic acid are used for fixation, staining and destaining of proteins in a gel after SDS-PAGE. To speed up the procedure, heating the staining solution in the microwave oven for a short time is frequently used. This usually results in evaporation of toxic or hazardous Methanol, Ethanol or 2-Propanol and a strong smell of acetic acid in the lab which should be avoided due to safety considerations. In a protocol originally published in two patent applications by E.M. Wondrak (US2001046709 (A1), US6319720 (B1)), an alternative composition of the staining solution is described in which no organic solvent or acid is used. The CBB is dissolved in bidistilled water (60-80mg of CBB G-250 per liter) and 35 mM HCl is added as the only other compound in the staining solution. The CBB staning of the gel is done after SDS-PAGE and thorough washing of the gel in bidistilled water. By heating the gel during the washing and staining steps, the process can be finished faster and no toxic or hazardous compunds are evaporating. The staining of proteins occurs already within 1 minute after heating the gel in staining solution and is fully developed after 15-30 min with a slightly blue background that is destained completely by prolonged washing of the stained gel in bidistilled water, without affecting the stained protein bands.

A short protocol for protein staining with Coomassie Brilliant Blue (CBB) G-250 in polyacrylamide gels is described without using organic solvents or acetic acid as in the classical staining procedures with CBB.

Organik Solvent ve Asetik Asit olmadan Jeller Coomassie G-250 ile Proteinlerin Boyama

In classical protein staining protocols using Coomassie Brilliant Blue (CBB), solutions with high contents of toxic and flammable organic solvents ...

Biyoloji

Mutagenesis and Functional Selection Protocols for Directed Evolution of Proteins in E. coli

The efficient generation of genetic diversity represents an invaluable molecular tool that can be used to label DNA synthesis, to create unique molecular signatures, or to evolve proteins in the laboratory. Here, we present a protocol that allows the generation of large (>1011) mutant libraries for a given target sequence. This method is based on replication of a ColE1 plasmid encoding the desired sequence by a low-fidelity variant of DNA polymerase I (LF-Pol I). The target plasmid is transformed into a mutator strain of E. coli and plated on solid media, yielding between 0.2 and 1 mutations/kb, depending on the location of the target gene. Higher mutation frequencies are achieved by iterating this process of mutagenesis. Compared to alternative methods of mutagenesis, our protocol stands out for its simplicity, as no cloning or PCR are involved. Thus, our method is ideal for mutational labeling of plasmids or other Pol I templates or to explore large sections of sequence space for the evolution of activities not present in the original target. The tight spatial control that PCR or randomized oligonucleotide-based methods offer can also be achieved through subsequent cloning of specific sections of the library. Here we provide protocols showing how to create a random mutant library and how to establish drug-based selections in E. coli to identify mutants exhibiting new biochemical activities.

Mutagenesis and Functional Selection Protocols for Directed Evolution of Proteins in E. coli

Here we demonstrate a simple protocol to create a random mutant library for a given target sequence. We show how this method, which is performed in vivo in Escherichia coli, can be coupled with functional selections to evolve new enzymatic activities.

Proteinlerin Yönetmen Evolution Mutagenez ve Fonksiyonel Seçim Protokolleri E. coli</em

The efficient generation of genetic diversity represents an invaluable molecular tool that can be used to label DNA synthesis, to create unique molecular ...

Purification of Hsp104, a Protein Disaggregase

Hsp104 is a hexameric AAA+ protein1 from yeast, which couples ATP hydrolysis to protein disaggregation2-10 (Fig. 1). This activity imparts two key selective advantages. First, renaturation of disordered aggregates by Hsp104 empowers yeast survival after various protein-misfolding stresses, including heat shock3,5,11,12. Second, remodeling of cross-beta amyloid fibrils by Hsp104 enables yeast to exploit myriad prions (infectious amyloids) as a reservoir of beneficial and heritable phenotypic variation13-22. Remarkably, Hsp104 directly remodels preamyloid oligomers and amyloid fibrils, including those comprised of the yeast prion proteins Sup35 and Ure223-30. This amyloid-remodeling functionality is a specialized facet of yeast Hsp104. The E. coli orthologue, ClpB, fails to remodel preamyloid oligomers or amyloid fibrils26,31,32.
Hsp104 orthologues are found in all kingdoms of life except, perplexingly, animals. Indeed, whether animal cells possess any enzymatic system that couples protein disaggregation to renaturation (rather than degradation) remains unknown33-35. Thus, we and others have proposed that Hsp104 might be developed as a therapeutic agent for various neurodegenerative diseases connected with the misfolding of specific proteins into toxic preamyloid oligomers and amyloid fibrils4,7,23,36-38. There are no treatments that directly target the aggregated species associated with these diseases. Yet, Hsp104 dissolves toxic oligomers and amyloid fibrils composed of alpha-synuclein, which are connected with Parkinson's Disease23 as well as amyloid forms of PrP39. Importantly, Hsp104 reduces protein aggregation and ameliorates neurodegeneration in rodent models of Parkinson's Disease23 and Huntington's disease38. Ideally, to optimize therapy and minimize side effects, Hsp104 would be engineered and potentiated to selectively remodel specific aggregates central to the disease in question4,7. However, the limited structural and mechanistic understanding of how Hsp104 disaggregates such a diverse repertoire of aggregated structures and unrelated proteins frustrates these endeavors30,40-42.
To understand the structure and mechanism of Hsp104, it is essential to study the pure protein and reconstitute its disaggregase activity with minimal components. Hsp104 is a 102kDa protein with a pI of ~5.3, which hexamerizes in the presence of ADP or ATP, or at high protein concentrations in the absence of nucleotide43-46. Here, we describe an optimized protocol for the purification of highly active, stable Hsp104 from E. coli. The use of E. coli allows simplified large-scale production and our method can be performed quickly and reliably for numerous Hsp104 variants. Our protocol increases Hsp104 purity and simplifies His6-tag removal compared to a previous purification method from E. coli47. Moreover, our protocol is more facile and convenient than two more recent protocols26,48.

Here, we describe a protocol for the purification of highly active Hsp104, a hexameric AAA+ protein from yeast, which couples ATP hydrolysis to protein disaggregation. This scheme exploits a His6-tagged construct for affinity purification from E. coli followed by anion-exchange chromatography, His6-tag removal with TEV protease, and size-exclusion chromatography.

Hsp104 saflaştırılması, Protein Disaggregase

Hsp104 is a hexameric AAA+ protein1 from yeast, which couples ATP hydrolysis to protein disaggregation2-10 (Fig. 1). This activity imparts two key ...

Identification of Protein Complexes in Escherichia coli using Sequential Peptide Affinity Purification in Combination with Tandem Mass Spectrometry

Since most cellular processes are mediated by macromolecular assemblies, the systematic identification of protein-protein interactions (PPI) and the identification of the subunit composition of multi-protein complexes can provide insight into gene function and enhance understanding of biological systems1, 2. Physical interactions can be mapped with high confidence vialarge-scale isolation and characterization of endogenous protein complexes under near-physiological conditions based on affinity purification of chromosomally-tagged proteins in combination with mass spectrometry (APMS). This approach has been successfully applied in evolutionarily diverse organisms, including yeast, flies, worms, mammalian cells, and bacteria1-6. In particular, we have generated a carboxy-terminal Sequential Peptide Affinity (SPA) dual tagging system for affinity-purifying native protein complexes from cultured gram-negative Escherichia coli, using genetically-tractable host laboratory strains that are well-suited for genome-wide investigations of the fundamental biology and conserved processes of prokaryotes1, 2, 7. Our SPA-tagging system is analogous to the tandem affinity purification method developed originally for yeast8, 9, and consists of a calmodulin binding peptide (CBP) followed by the cleavage site for the highly specific tobacco etch virus (TEV) protease and three copies of the FLAG epitope (3X FLAG), allowing for two consecutive rounds of affinity enrichment. After cassette amplification, sequence-specific linear PCR products encoding the SPA-tag and a selectable marker are integrated and expressed in frame as carboxy-terminal fusions in a DY330 background that is induced to transiently express a highly efficient heterologous bacteriophage lambda recombination system10. Subsequent dual-step purification using calmodulin and anti-FLAG affinity beads enables the highly selective and efficient recovery of even low abundance protein complexes from large-scale cultures. Tandem mass spectrometry is then used to identify the stably co-purifying proteins with high sensitivity (low nanogram detection limits).
Here, we describe detailed step-by-step procedures we commonly use for systematic protein tagging, purification and mass spectrometry-based analysis of soluble protein complexes from E. coli, which can be scaled up and potentially tailored to other bacterial species, including certain opportunistic pathogens that are amenable to recombineering. The resulting physical interactions can often reveal interesting unexpected components and connections suggesting novel mechanistic links. Integration of the PPI data with alternate molecular association data such as genetic (gene-gene) interactions and genomic-context (GC) predictions can facilitate elucidation of the global molecular organization of multi-protein complexes within biological pathways. The networks generated for E. coli can be used to gain insight into the functional architecture of orthologous gene products in other microbes for which functional annotations are currently lacking.

Identification of Protein Complexes in Escherichia coli using Sequential Peptide Affinity Purification in Combination with Tandem Mass Spectrometry

Affinity purification of tagged proteins in combination with mass spectrometry (APMS) is a powerful method for the systematic mapping of protein interaction networks and for investigating the mechanistic basis of biological processes. Here, we describe an optimized sequential peptide affinity (SPA) APMS procedure developed for the bacterium Escherichia coli that can be used to isolate and characterize stable multi-protein complexes to near homogeneity even starting from low copy numbers per cell.

Protein Kompleksi belirlenmesi<em&gt; Escherichia coli</em&gt; Tandem Kütle Spektrometresi ile Kombine Sıralı Peptid Affinity Arıtma kullanarak

Since most cellular processes are mediated by macromolecular assemblies, the systematic identification of protein-protein interactions (PPI) and the ...

Coupled Assays for Monitoring Protein Refolding in Saccharomyces cerevisiae

Proteostasis, defined as the combined processes of protein folding/biogenesis, refolding/repair, and degradation, is a delicate cellular balance that must be maintained to avoid deleterious consequences 1. External or internal factors that disrupt this balance can lead to protein aggregation, toxicity and cell death. In humans this is a major contributing factor to the symptoms associated with neurodegenerative disorders such as Huntington's, Parkinson's, and Alzheimer's diseases 10. It is therefore essential that the proteins involved in maintenance of proteostasis be identified in order to develop treatments for these debilitating diseases. This article describes techniques for monitoring in vivo protein folding at near-real time resolution using the model protein firefly luciferase fused to green fluorescent protein (FFL-GFP). FFL-GFP is a unique model chimeric protein as the FFL moiety is extremely sensitive to stress-induced misfolding and aggregation, which inactivates the enzyme 12. Luciferase activity is monitored using an enzymatic assay, and the GFP moiety provides a method of visualizing soluble or aggregated FFL using automated microscopy. These coupled methods incorporate two parallel and technically independent approaches to analyze both refolding and functional reactivation of an enzyme after stress. Activity recovery can be directly correlated with kinetics of disaggregation and re-solubilization to better understand how protein quality control factors such as protein chaperones collaborate to perform these functions. In addition, gene deletions or mutations can be used to test contributions of specific proteins or protein subunits to this process. In this article we examine the contributions of the protein disaggregase Hsp104 13, known to partner with the Hsp40/70/nucleotide exchange factor (NEF) refolding system 5, to protein refolding to validate this approach.

Coupled Assays for Monitoring Protein Refolding in Saccharomyces cerevisiae

This article describes the use of a firefly luciferase-GFP fusion protein to investigate in vivo protein folding in Saccharomyces cerevisiae. Using this reagent, refolding of a model heat-denatured protein can be monitored simultaneously by fluorescence microscopy and an enzymatic assay to probe the roles of proteostasis network components in protein quality control.

İzlenmesi protein refolding için birleştiğinde Tahliller<em&gt; Saccharomyces cerevisiae</em

Proteostasis, defined as the combined processes of protein folding/biogenesis, refolding/repair, and degradation, is a delicate cellular balance that must ...

Purification of the Cystic Fibrosis Transmembrane Conductance Regulator Protein Expressed in Saccharomyces cerevisiae

Defects in the cystic fibrosis transmembrane conductance regulator (CFTR) protein cause cystic fibrosis (CF), an autosomal recessive disease that currently limits the average life expectancy of sufferers to &#60;40 years of age. The development of novel drug molecules to restore the activity of CFTR is an important goal in the treatment CF, and the isolation of functionally active CFTR is a useful step towards achieving this goal.
We describe two methods for the purification of CFTR from a eukaryotic heterologous expression system, S. cerevisiae. Like prokaryotic systems, S. cerevisiae can be rapidly grown in the lab at low cost, but can also traffic and posttranslationally modify large membrane proteins. The selection of detergents for solubilization and purification is a critical step in the purification of any membrane protein. Having screened for the solubility of CFTR in several detergents, we have chosen two contrasting detergents for use in the purification that allow the final CFTR preparation to be tailored to the subsequently planned experiments.
In this method, we provide comparison of the purification of CFTR in dodecyl-&#946;-D-maltoside (DDM) and 1-tetradecanoyl-sn-glycero-3-phospho-(1&#39;-rac-glycerol) (LPG-14). Protein purified in DDM by this method shows ATPase activity in functional assays. Protein purified in LPG-14 shows high purity and yield, can be employed to study post-translational modifications, and can be used for structural methods such as small-angle X-ray scattering and electron microscopy. However it displays significantly lower ATPase activity.

Purification of the Cystic Fibrosis Transmembrane Conductance Regulator Protein Expressed in Saccharomyces cerevisiae

Heterologous expression and purification of the cystic fibrosis transmembrane conductance regulator (CFTR) are significant challenges and limiting factors in the development of drug therapies for cystic fibrosis. This protocol describes two methods for the isolation of milligram quantities of CFTR suitable for functional and structural studies.&#160;

Olarak ifade edilmiştir kistik fibroz transmembran kondüktans regülatörü Protein Saflaştırılması<em&gt; Saccharomyces cerevisiae</em

Defects in the cystic fibrosis transmembrane conductance regulator (CFTR) protein cause cystic fibrosis (CF), an autosomal recessive disease that ...

High Throughput Quantitative Expression Screening and Purification Applied to Recombinant Disulfide-rich Venom Proteins Produced in E. coli

Escherichia coli (E. coli) is the most widely used expression system for the production of recombinant proteins for structural and functional studies. However, purifying proteins is sometimes challenging since many proteins are expressed in an insoluble form. When working with difficult or multiple targets it is therefore recommended to use high throughput (HTP) protein expression screening on a small scale (1-4&#160;ml cultures) to quickly identify conditions for soluble expression. To cope with the various structural genomics programs of the lab, a quantitative (within a range of 0.1-100 mg/L culture of recombinant protein) and HTP protein expression screening protocol was implemented and validated on thousands of proteins. The protocols were automated with the use of a liquid handling robot but can also be performed manually without specialized equipment.
Disulfide-rich venom proteins are gaining increasing recognition for their potential as therapeutic drug leads. They can be highly potent and selective, but their complex disulfide bond networks make them challenging to produce. As a member of the FP7 European Venomics project (<a href="http://www.venomics.eu">www.venomics.eu</a>), our challenge is to develop successful production strategies with the aim of producing thousands of novel venom proteins for functional characterization. Aided by the redox properties of disulfide bond isomerase DsbC, we adapted our HTP production pipeline for the expression of oxidized, functional venom peptides in the E. coli cytoplasm. The protocols are also applicable to the production of diverse disulfide-rich proteins. Here we demonstrate our pipeline applied to the production of animal venom proteins. With the protocols described herein it is likely that soluble disulfide-rich proteins will be obtained in as little as a week. Even from a small scale, there is the potential to use the purified proteins for validating the oxidation state by mass spectrometry, for characterization in pilot studies, or for sensitive micro-assays.

High Throughput Quantitative Expression Screening and Purification Applied to Recombinant Disulfide-rich Venom Proteins Produced in E. coli

A protocol for the quantitative, high throughput expression screening and analytical purification of fusion proteins from small-scale Escherichia coli cultures is described and applied to the expression of disulfide-rich animal venom protein targets.

Üretilen Rekombinant Disülfid zengin Venom Proteinler Uygulanan Yüksek Randımanlı Sayısal Anlatım Tarama ve Arıtma<em&gt; E. coli</em

Escherichia coli (E. coli) is the most widely used expression system for the production of recombinant proteins for structural and functional studies. ...

Non-chromatographic Purification of Recombinant Elastin-like Polypeptides and their Fusions with Peptides and Proteins from Escherichia coli

Elastin-like polypeptides are repetitive biopolymers that exhibit a lower critical solution temperature phase transition behavior, existing as soluble unimers below a characteristic transition temperature and aggregating into micron-scale coacervates above their transition temperature. The design of elastin-like polypeptides at the genetic level permits precise control of their sequence and length, which dictates their thermal properties. Elastin-like polypeptides are used in a variety of applications including biosensing, tissue engineering, and drug delivery, where the transition temperature and biopolymer architecture of the ELP can be tuned for the specific application of interest. Furthermore, the lower critical solution temperature phase transition behavior of elastin-like polypeptides allows their purification by their thermal response, such that their selective coacervation and resolubilization allows the removal of both soluble and insoluble contaminants following expression in Escherichia coli. This approach can be used for the purification of elastin-like polypeptides alone or as a purification tool for peptide or protein fusions where recombinant peptides or proteins genetically appended to elastin-like polypeptide tags can be purified without chromatography. This protocol describes the purification of elastin-like polypeptides and their peptide or protein fusions and discusses basic characterization techniques to assess the thermal behavior of pure elastin-like polypeptide products.

Non-chromatographic Purification of Recombinant Elastin-like Polypeptides and their Fusions with Peptides and Proteins from Escherichia coli

Elastin-like polypeptides are stimulus-responsive biopolymers with applications ranging from recombinant protein purification to drug delivery. This protocol describes the purification and characterization of elastin-like polypeptides and their peptide or protein fusions from Escherichia coli using their lower critical solution temperature phase transition behavior as a simple alternative to chromatography.

Peptidler ve proteinler ile rekombinant Elastin gibi Polipeptitlerin ve Fusions olmayan kromatografik saflaştırma<em&gt; Escherichia coli</em

Elastin-like polypeptides are repetitive biopolymers that exhibit a lower critical solution temperature phase transition behavior, existing as soluble ...

Green Fluorescent Protein-based Expression Screening of Membrane Proteins in Escherichia coli

The production of recombinant membrane proteins for structural and functional studies remains technically challenging due to low levels of expression and the inherent instability of many membrane proteins once solubilized in detergents. A protocol is described that combines ligation independent cloning of membrane proteins as GFP fusions with expression in Escherichia coli detected by GFP fluorescence. This enables the construction and expression screening of multiple membrane protein/variants to identify candidates suitable for further investment of time and effort. The GFP reporter is used in a primary screen of expression by visualizing GFP fluorescence following SDS polyacrylamide gel electrophoresis (SDS-PAGE). Membrane proteins that show both a high expression level with minimum degradation as indicated by the absence of free GFP, are selected for a secondary screen. These constructs are scaled and a total membrane fraction prepared and solubilized in four different detergents. Following ultracentrifugation to remove detergent-insoluble material, lysates are analyzed by fluorescence detection size exclusion chromatography (FSEC). Monitoring the size exclusion profile by GFP fluorescence provides information about the mono-dispersity and integrity of the membrane proteins in different detergents. Protein: detergent combinations that elute with a symmetrical peak with little or no free GFP and minimum aggregation are candidates for subsequent purification. Using the above methodology, the heterologous expression in E. coli of SED (shape, elongation, division, and sporulation) proteins from 47 different species of bacteria was analyzed. These proteins typically have ten transmembrane domains and are essential for cell division. The results show that the production of the SEDs orthologues in E. coli was highly variable with respect to the expression levels and integrity of the GFP fusion proteins. The experiment identified a subset for further investigation.

Green Fluorescent Protein-based Expression Screening of Membrane Proteins in Escherichia coli

A streamlined approach to screening for the expression of recombinant membrane proteins in Escherichia coli based on fusion to green fluorescent protein is presented.

Membran proteinlerinin Yeşil floresan proteini temelli Ekspresyon elemesinde<em&gt; Escherichia coli</em

The production of recombinant membrane proteins for structural and functional studies remains technically challenging due to low levels of expression and ...

Phage-mediated Delivery of Targeted sRNA Constructs to Knock Down Gene Expression in E. coli

RNA-mediated knockdowns are widely used to control gene expression. This versatile family of techniques makes use of short RNA (sRNA) that can be synthesized with any sequence and designed to complement any gene targeted for silencing. Because sRNA constructs can be introduced to many cell types directly or using a variety of vectors, gene expression can be repressed in living cells without laborious genetic modification. The most common RNA knockdown technology, RNA interference (RNAi), makes use of the endogenous RNA-induced silencing complex (RISC) to mediate sequence recognition and cleavage of the target mRNA. Applications of this technique are therefore limited to RISC-expressing organisms, primarily eukaryotes. Recently, a new generation of RNA biotechnologists have developed alternative mechanisms for controlling gene expression through RNA, and so made possible RNA-mediated gene knockdowns in bacteria. Here we describe a method for silencing gene expression in E. coli that functionally resembles RNAi. In this system a synthetic phagemid is designed to express sRNA, which may designed to target any sequence. The expression construct is delivered to a population of E. coli cells with non-lytic M13 phage, after which it is able to stably replicate as a plasmid. Antisense recognition and silencing of the target mRNA is mediated by the Hfq protein, endogenous to E. coli. This protocol includes methods for designing the antisense sRNA, constructing the phagemid vector, packaging the phagemid into M13 bacteriophage, preparing a live cell population for infection, and performing the infection itself. The fluorescent protein mKate2 and the antibiotic resistance gene chloramphenicol acetyltransferase (CAT) are targeted to generate representative data and to quantify knockdown effectiveness.

Phage-mediated Delivery of Targeted sRNA Constructs to Knock Down Gene Expression in E. coli

We describe a method to knock down gene expression in a growing population of E. coli cells using sequence-targeted sRNA expression cassettes delivered by an M13 phagemid vector.