Bu eser DK52057 ve K.V.K. X.P için gelen NIH DK107498 kurumsal eğitim grant 2T32DK007201 NIH üzerinden tarafından desteklenen araştırma hibe tarafından desteklenmiştir.

1. peptid işlenmesi
<ol><li>Tasarım ve peptid sipariş<ol>
<li>Peptid istenen sırayı seçin ve myc epitope (EQKLISEED), onun ya da N - veya C-terminus gibi bir etiket ekleyin.</li>
		<li>Peptid suda peptid çözünürlük hesap makinesi http://pepcalc.com/peptide-solubility-calculator.php kullanarak tahmin edilen çözünürlük kontrol edin. Çözünürlük düşük ise, şarj dengeyi değiştirmek için başka bir suda çözünen etiket eklemeyi deneyin. Not: Biz N terminus (Myc-fll-GLUT4) ilk luminal döngü (fll) için myc epitope (kalın yazı tipi) ile öğesini GLUT4, karşılık gelen peptid kullanılır: "iyi" tahmin edilen suda var EQKLISEEDLNAPQKVIEQSYNATWLGRQGPGGPSSIPPGTLTTLWA .</li>
		<li>En az % 75 ile özel peptid sipariş saflık tahlil için yeterli olan ve çözünürlük testi için sağlayıcınıza danışın. Sipariş peptid eriterek ile beklenmedik sorunlar durumunda en az iki aliquots ayrı. Not: Myc-fll-GLUT4 iki aliquots emri verildi. Ultrasaf suda bildirilen onun ≤10 mg/mL'dir.</li>
	</ol>
</li>
	<li>Peptid eriterek Not: En iyi solvent ultrasaf su var. Peptid suda çözünür olmak görünmüyorsa yönergeler için http://www.genscript.com/peptide_solubility_and_stablity.html bakın.<ol>
<li>100 x peptid ultrasaf su veya 100 μg/mL konsantrasyonu ile seçim, arabellek çalışma çözüm hazırlamak.</li>
		<li>50-100 µL aliquots belgili tanımlık eriyik ayırmak ve onları-20 ° C'de depolayın</li>
	</ol>
</li>
</ol>2. hücre işleme
<ol><li>Hücre kültürü<ol>
<li>Vahşi türü (WT) hücreleri bir negatif kontrol ve altı histidines (HISP) ile öğesini hedef protein ifade hücreleri olarak kullanın. Not: Biz 3T3 L1 ön adiposit stabil Sortilin-myc/O'nun5ile transfected kullanılır.</li>
		<li>Dulbecco'nın modifiye kartal orta (DMEM) yüksek şeker % 10 buzağı sığır serum ile desteklenmiş, hücrelerin büyümesine glutamin (2 mM) ve penisilin/streptomisin (5 μg/mL) % 10 CO237 ° C'de.</li>
		<li>Dört 10 cm yemekleri hücre oturup iki tane HISP ile transfect ve diğer iki denetim plazmid (WT) ile transfect. 48 h transfection sonra hücrelerin % 80-90 confluency ulaştırılması gerekmektedir.</li>
	</ol>
</li>
	<li>Hücre Lysates hazırlanması<ol>
<li>Lizis arabellek (10 mM Hepes, 30 mM NaCl, %5 gliserol, 10 mM Imidazole, % 0.5 Triton X-100 ve proteaz inhibitörü EDTA kokteyl O'nun öğesini proteinler, pH 7.4 yalıtımı için) hazırlamak ve 4'te tutmak ° c</li>
		<li>Hücreleri üç kez 10 mL 1 x fosfat tamponlu tuz (PBS) 4 ° C'de yıkama</li>
		<li>Bulaşıkları buza koy ve 500 µL lizis arabelleği her yemek için ekleyin. Bir hücre kazıyıcı kullanarak hücre lysates hasat.</li>
		<li>Lysate her yemeğin farklı 1,5 mL tüp içine yerleştirin. Tüpler WT-pH6, WT-pH8, HISP-pH6, HISP-pH8 olarak etiketleyin.</li>
		<li>Hücre lysates bir şırınga ile 26 G iğne ile beş kez yukarı ve aşağı, tam lizis için geçmek.</li>
		<li>Hücre lysates, 16.000 x g 4 ° C'de 10 dakika santrifüj kapasitesi</li>
		<li>Supernatants yeni aynı şekilde etiketlenmiş tüpler aktarın.</li>
		<li>Protein konsantrasyonu BCA Protein tahlil seti veya diğer seti kullanarak analiz.</li>
		<li>Lizis arabellek kullanarak, tüm dört lysates protein konsantrasyonu eşitlemek.</li>
		<li>Bir küçük (ca. 20 µL) aliquot, her lysate ayrı ve olası kontrol deneyleri ve/veya sorun çekim için-20 ° C'de tutun.</li>
	</ol>
</li>
</ol>3. HisPur kobalt boncuk için O'nun öğesini proteinlerin bağlama
<ol><li>Piyasada bulunan yıkama arabellek kullanın veya bir (50 mM Na2HPO4/NaH2PO4, 300 mM NaCl, 20 mM imidazole, pH 8) hazırlamak ve 4 ° C'de tutmak</li>
	<li>Yıkama hazırlamak pH 6 tarafından tittering yıkama tampon pH 8 ile birlikte tut HCl. bu 4 ° C'de tampon</li>
	<li>Yavaşça homojen süspansiyon yapmak kobalt boncuk şişe girdap.</li>
	<li>Kobalt boncuk süspansiyon 40 µL yukarıdaki gibi işaretlenmiş dört 1,5 mL tüpler içine (Adım 2.2.4) dağıtmak.</li>
	<li>1 mL lizis arabellek her tüp için ekleyin ve 5 s. aspiratı süpernatant için 1000 x g de tüpler santrifüj kapasitesi ve 40 μL lizis arabelleği için kapatılan boncuk ekleyin.</li>
	<li>Hücre lysates karşılık gelen borular için ekleyin.</li>
	<li>Tüpler için 90 dk 4 ° c 20 d/d tüp rotator üzerinde kuluçkaya.</li>
	<li>Tüpler santrifüj kapasitesi 1000 x g 5 s ve süpernatant toplamak için. 4 ° C'de süpernatant tutmak</li>
	<li>PH 8 veya pH 6 yıkama arabellek 500 µL karşılık gelen borular için ekleyin ve boncuk hafifçe yeniden askıya alma.</li>
	<li>1000 x g 5 s ve atmak için de tüpler santrifüj kapasitesi supernatants.</li>
	<li>Adım 3,9 ve 3.10 için dört kez tekrarlayın.</li>
</ol>4. peptid üstündeki immobilize O'nun öğesini Protein için bağlama
<ol><li>Peptid (1.2.1. adım) 100 x çalışma çözümü kullanarak 1 çalışma çözümler pH 6 veya pH 8 yıkama arabellek (her iki 100 µL aliquots, 1 µg/mL) x hazırlamak.</li>
	<li>1 x peptid çözeltinin 100 μL karşılık gelen pH ile yıkanmış boncuk ekleyin.</li>
	<li>Boncuk 20 rpm bir tüp rotator üzerinde 4 ° C'de 30 dk için kuluçkaya.</li>
	<li>1000 x g 5 için de tüpler santrifüj kapasitesi s, süpernatant toplamak ve -20 ° C'de tutmak</li>
	<li>Adım 3,9 ve 3.10 için dört kez tekrarlayın. Not: olası arka plan azaltmak için aşağıdaki adımları adımları 4.4 & 4.5 yerini alabilir.</li>
	<li>Onları olduğu gibi adım 2.2.4 etiket ve sütunları koleksiyon tüplerde yer 30 mikron gözenekleri dört mikro sütunlarla alın.</li>
	<li>Sütunlara kuluçka karışımı adım 4.3, tamamlanması aktardıktan sonra çözüm yerçekimi tarafından geçmesine izin verin. -20 ° C'de aracılığıyla akış devam</li>
	<li>Yıkama tamponunun pH 6 veya pH 8 karşılık gelen sütunları aracılığıyla ile 500 µL yerçekimi tarafından geçmek. Aracılığıyla akış atmak.</li>
	<li>Adımı yineleyin 4,8 dört kez.</li>
	<li>Son yıkama sonra santrifüj kapasitesi 1000 x g 15 sütun s.</li>
</ol>5. elüsyon kobalt boncuk üzerinden
<ol><li>Kullanım ticari Tricine örnek arabellek (200 mM Tris-HCl, % 40 gliserol, % 2 SDS, %0,04 Coomassie mavi, pH 6.8) ve β-mercaptoethanol % 2 son konsantrasyonu ekleyin.</li>
	<li>Tricine örnek arabelleği (β-mercaptoethanol ile) 40 µL yıkanmış boncuk ve girdap örnek ekleyin.</li>
	<li>Örnekleri 100 ° C'de 10 dakika için ısı girdap örnekleri daha ve 1000 x g 5 için de tüpler santrifüj kapasitesi s. Not: elüsyon olası nonspesifik bağlama azaltmak için aşağıdaki adımları adımları 5.1-5,3 yerini alabilir.</li>
	<li>40 μL elüsyon Imidazole arabelleği (50 mM Na2HPO4/NaH2PO4, 300 mM NaCl, 0.25 M imidazole) yıkanmış için eklemek boncuk, girdap ve tüpler, oda sıcaklığında 20 dk için kuluçkaya.</li>
	<li>3000 x g 30 de tüpler santrifüj kapasitesi s, süpernatant (eluted örnekleri) toplamak ve yeni etiketli tüpler için transfer.</li>
	<li>Tricine örnek arabelleği 40 μL her tüp eklemek, örnekleri 10 dk 100 ° C, girdap ve santrifüj için ısı tüpler 1000 x g 5 için de s. Not: mikro sütun kullanılıyorsa, elüsyon arabellek için yıkanmış boncuklar, eklemek için 20 dk kuluçkaya ve 8.000 x g 2 min için de Santrifüjü tarafından elüsyon toplamak. Not: Elektroforez gerçekleştirilir kadar örnekleri-20 ° C'de tutulabilir.</li>
</ol>6. Elektroforez ve Western Blot
Not: Örnekleri SDS-sayfa ve sonraki Western Blot tarafından ayrılması için hazırsınız demektir. Jel Elektroforez (https://www.jove.com/science-education/5065/the-western-blot) aşağıdaki değişiklikler ile protokolünden izleyin.
<ol><li>Piyasada bulunan 10-%20 Tricine degrade jelleri kullanın.</li>
	<li>Üzerinde jel, eluted örnekleri 20 µL ve lysates (Adım 2.2.10) 20 µL yük. Sorun çekim için bu 20 µL ilişkisiz malzeme (Adım 3.8) yüklemek için tavsiye edilir ve 10 ng peptid; yükleme önce bu örnekler için Tricine örnek arabellek eşit miktarda ekleyin.</li>
	<li>Elektroforez ticari Tris/Tricine/SDS arabellek (100 mM Tris, 100 mM Tricine ve % 0.1 SDS, pH 8.3) çalıştıran içinde yerine getirir.</li>
	<li>Malzeme % 20 metanol ile desteklenen Aktarım arabellek (25 mM Tris Bankası, 192 mM glisin, pH 8.4) kullanarak 0,45 µm nitroselüloz membran üzerine jel transfer.</li>
	<li>Membran ile % 3 blok sığır Serum Albumin (BSA) oda sıcaklığında 1 h için. Önceden lekeli molekül ağırlığı işaretçileri kılavuz olarak kullanarak, membran yatay kesme, HISP karşı antikor ile üst kısmında leke ve alt kısmında bir antikor myc öğesini peptid tanımlamak için myc epitope karşı ile leke. Not: HISP ve Myc-fll-GLUT4 bir anti-myc antikor ile tespit edilebilir beri bizim durumda, membran kesme gerekli değildir.</li>
</ol>7. analiz sonuçları
<ol><li>Bir görüntü istasyonu veya ImageJ programı kullanarak tüm Western blot sinyalleri yoğunluğunu ölçmek.</li>
	<li>Myc öğesini peptid HISP sinyalini her iki pH değerlerinde karşı gelen sinyal normalleştirmek.</li>
</ol>

<ol>
	<li>Bogan, J. S. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Regulation+of+glucose+transporter+translocation+in+health+and+diabetes.">Regulation of glucose transporter translocation in health and diabetes.</a> Annu Rev Biochem. 81, 507-532 (2012).</li><li>Kandror, K. V., Pilch, P. F. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+sugar+is+sIRVed:+sorting+Glut4+and+its+fellow+travelers.">The sugar is sIRVed: sorting Glut4 and its fellow travelers.</a> Traffic. 12 (6), 665-671 (2011).</li><li>Pan, X., Zaarur, N., Singh, M., Morin, P., Kandror, K. V. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Sortilin+and+retromer+mediate+retrograde+transport+of+Glut4+in+3T3-L1+adipocytes.">Sortilin and retromer mediate retrograde transport of Glut4 in 3T3-L1 adipocytes.</a> Mol Biol Cell. 28 (12), 1667-1675 (2017).</li><li>Kim, J., Kandror, K. V. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+first+luminal+loop+confers+insulin+responsiveness+to+the+glucose+transporter+4.">The first luminal loop confers insulin responsiveness to the glucose transporter 4.</a> Mol Biol Cell. 23 (5), 910-917 (2012).</li><li>Shi, J., Kandror, K. V. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Sortilin+is+essential+and+sufficient+for+the+formation+of+Glut4-storage+vesicles+in+3T3-L1+adipocytes.">Sortilin is essential and sufficient for the formation of Glut4-storage vesicles in 3T3-L1 adipocytes.</a> Dev Cell. 9 (1), 99-108 (2005).</li><li>Coutinho, M. F., Prata, M. J., Alves, S. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=A+shortcut+to+the+lysosome:+the+mannose-6-phosphate-independent+pathway.">A shortcut to the lysosome: the mannose-6-phosphate-independent pathway.</a> Mol Genet Metab. 107 (3), 257-266 (2012).</li><li>Willnow, T. E., Petersen, C. M., Nykjaer, A. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=VPS10P-domain+receptors+-+regulators+of+neuronal+viability+and+function.">VPS10P-domain receptors - regulators of neuronal viability and function.</a> Nat Rev Neurosci. 9 (12), 899-909 (2008).</li><li>Mazella, J., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+100-kDa+neurotensin+receptor+is+gp95/sortilin,+a+non-G-protein-coupled+receptor.">The 100-kDa neurotensin receptor is gp95/sortilin, a non-G-protein-coupled receptor.</a> J Biol Chem. 273 (41), 26273-26276 (1998).</li><li>Ni, X., Morales, C. R. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+Lysosomal+Trafficking+of+Acid+Sphingomyelinase+is+Mediated+by+Sortilin+and+Mannose+6-phosphate+Receptor.">The Lysosomal Trafficking of Acid Sphingomyelinase is Mediated by Sortilin and Mannose 6-phosphate Receptor.</a> Traffic. 7 (7), 889-902 (2006).</li><li>Westergaard, U. B., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Functional+organization+of+the+sortilin+Vps10p+domain.">Functional organization of the sortilin Vps10p domain.</a> J Biol Chem. 279 (48), 50221-50229 (2004).</li><li>Nykjaer, A., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Sortilin+is+essential+for+proNGF-induced+neuronal+cell+death.">Sortilin is essential for proNGF-induced neuronal cell death.</a> Nature. 427 (6977), 843-848 (2004).</li></ol>

Yazarlar ifşa gerek yok.

Sortilin her iki sinyal plazma zarı ve hücre içi sıralama olaylar6,7dahil bir evrimsel korunmuş çok ligand protein reseptörü var. Ancak, deterjanlar için duyarlı olmak sortilin etkileşim bazı bağlama ortakları ile göründüğü gibi otantik sortilin'ın ligandlar (bazıları luminal veya integral membran proteinlerinin olan) için arama karmaşıktır. Bu nedenle, bir kolay ve protein-protein etkileşimleri, türleri çalışmak için yaygın bir y...

GLUT4 nerede insülin etkisi sonrası prandial kan glikoz izni1aracılık eder yağ ve kas hücrelerinde ağırlıklı olarak gösterilen bir glikoz taşıyıcı proteindir. Çok istikrarlı bir protein olmak, GLUT4 translasyon düzeyinde düzenlenir. İnsülin yokluğunda GLUT4 büyük ölçüde plazma membran (dolayısıyla düşük Bazal geçirgenliği glikoz için) gelen söz konusu değildir ve küçük insülin duyarlı veziküller (IRVs) hücre içinde ağırlıklı olarak yerelleştirilmiştir ve temsil etmek büyük olasılıkla trans-Golgi ağ (TGN) Irv donör bölüm. İnsülin yönetim, üzerine IRVs plazma zarı ile sigorta ve işleyişi siteye GLUT4 teslim. Bu glikoz alımı adiposit ve iskelet miyositler kandan 10'a 40-fold yükselir böylece bu glikoz, plazma membran geçirgenliği artar. İnsülin çekilme sonra GLUT4 erken/sıralama endosomes içselleştirilmiş ve IRVs yeniden kurulan nerede TGN alındı. Her iki sıralama adımlar GLUT4 yolu, Yani çevresel erken endosomes tarafından ulaşım perinükleer TGN için ve IRVs oluşumu üzerinde membranlar Vps10p aile üyesi tarafından bir türü temsil eden sortilin, etkin TGN donör ben transmembran protein ve sıralama reseptör. Bir modeline göre sortilin bir transmembran iskele protein çalışır: GLUT4 endosomes ve TGN Lümen bağlar ve onun C-terminus2, retromer veya clathrin adaptörler donör membran aracılığıyla sitoplazmik tarafına acemi 3. bu GLUT4 dağıtım GLUT4 hücre içi bölmeleri arasında translocate veziküler taşıyıcıları içine kolaylaştırır.
Sortilin sitoplazmik kuyruk retromer ve çeşitli adaptör proteinler ile etkileşim iyi belgelenmiş oldu. Ancak, sortilin GLUT4 (ve onun diğer protein ligandlar birkaç) bağlantısını kanıtlamak için zor oldu. Özellikle, co-immunoprecipitate sortilin ve GLUT4 girişimlerini muhtemelen bu iki proteinler arasındaki etkileşimi deterjan duyarlı olması nedeniyle başarılı olmamıştır. Ayrıca, bir tipik taşıyıcı protein olarak GLUT4 12 transmembran etki alanları ve 6 luminal döngüler hangi herhangi bir bileşimini potansiyel bir sortilin bağlama site temsil edebilir vardır. Aynı zamanda, membran geçirgen DSP ve etkileşim ile Maya iki hibrid sistemde cross-linking önemli ortak yerelleştirme hücresinde, gibi dolaylı kanıtların büyük bir vücut önermek o sortilin GLUT4 için bağlayabilirsiniz. Ayrıca, ikinci yaklaşımı mutagenesis tarama alanin ile bir arada kullanarak, biz daha önce sortilin Vps10p etki öncelikle GLUT4 ilk luminal döngüsünü için bağlar belirledik. Ancak, böyle bir etkileşim memeli hücreleri olarak kanıtı kayıp olmuştur. Burada, asidik ortamda benzer O'nun öğesini sortilin kobalt reçine kullanarak ve kimyasal olarak sentezlenmiş peptid GLUT4 ilk luminal döngü pH 6 ve pH 8 karşılık gelen ile etkileşim kurabilir gösterdi transfected 3T3-L1 hücreleri izole ettim endosomal Lümen ve TGN membranlar nötr ortam Lümen içinde. Hiçbir peptid bağlama denetimi deneylerde nerede sigara transfected hücrelerden hazırlanan özü aynı boncuk dolu olduğunu tespit edilmiştir.

<table border="0" cellpadding="0" cellspacing="0" width="608">
	<tbody>
		<tr height="42">
			<td height="42" style="height:42px;width:216px;">Protease inhibitor cocktail</td>
			<td style="width:107px;">Sigma</td>
			<td style="width:119px;">P8849</td>
			<td style="width:167px;">for use in purification of histidine tag protein</td>
		</tr>
		<tr height="21">
			<td height="21" style="height:21px;width:216px;">Phosphate-Buffered Saline&#160;</td>
			<td style="width:107px;">Corning</td>
			<td style="width:119px;">21-040-CV</td>
			<td style="width:167px;">PBS</td>
		</tr>
		<tr height="21">
			<td height="21" style="height:21px;width:216px;">1mL Insulin Syringe U-100</td>
			<td style="width:107px;">BD</td>
			<td style="width:119px;">329652</td>
			<td style="width:167px;">26G x 1/2</td>
		</tr>
		<tr height="21">
			<td height="21" style="height:21px;width:216px;">BCA Protein Assay Kit</td>
			<td style="width:107px;">Pierce</td>
			<td style="width:119px;">23228</td>
			<td style="width:167px;"></td>
		</tr>
		<tr height="42">
			<td height="42" style="height:42px;width:216px;">Wash buffer</td>
			<td style="width:107px;">Boston BioProducts</td>
			<td style="width:119px;">BP-234</td>
			<td style="width:167px;">For His-tag protein purification</td>
		</tr>
		<tr height="42">
			<td height="42" style="height:42px;width:216px;">HisPur Cobalt Resin</td>
			<td style="width:107px;">Thermo Scientific</td>
			<td style="width:119px;">89964</td>
			<td style="width:167px;"></td>
		</tr>
		<tr height="63">
			<td height="63" style="height:63px;width:216px;">Tricine sample Buffer</td>
			<td style="width:107px;">Bio-Rad</td>
			<td style="width:119px;">161-0739</td>
			<td style="width:167px;">with SDS, bMercaptaethanol should be added</td>
		</tr>
		<tr height="63">
			<td height="63" style="height:63px;width:216px;">Elution&#160; Buffer</td>
			<td style="width:107px;">Boston BioProducts</td>
			<td style="width:119px;">BP-236</td>
			<td style="width:167px;">For His-tag protein purificationwith 250mM Imidazole</td>
		</tr>
		<tr height="63">
			<td height="63" style="height:63px;width:216px;">Mini-Protean Tris-Tricine precast gels 10-20%&#160;</td>
			<td style="width:107px;">Bio-Rad</td>
			<td style="width:119px;">456-3115</td>
			<td style="width:167px;">For seperation of peptide and small protein</td>
		</tr>
		<tr height="21">
			<td height="21" style="height:21px;width:216px;">Tris/Tricine/SDS running buffer&#160;</td>
			<td style="width:107px;">Bio-Rad</td>
			<td style="width:119px;">161-0744</td>
			<td style="width:167px;"></td>
		</tr>
		<tr height="42">
			<td height="42" style="height:42px;width:216px;">Transfer Buffer</td>
			<td style="width:107px;">Boston BioProducts</td>
			<td style="width:119px;">BP-190</td>
			<td style="width:167px;">Add 20% methanol</td>
		</tr>
		<tr height="42">
			<td height="42" style="height:42px;width:216px;">Nitrocellulose membrane&#160; 0.45 mm</td>
			<td style="width:107px;">Bio-Rad</td>
			<td style="width:119px;">1620115</td>
			<td style="width:167px;"></td>
		</tr>
		<tr height="21">
			<td height="21" style="height:21px;width:216px;">Bovine Serum Albumin</td>
			<td style="width:107px;">Sigma</td>
			<td style="width:119px;">A9647</td>
			<td style="width:167px;">BSA</td>
		</tr>
		<tr height="21">
			<td height="21" style="height:21px;width:216px;">Anti Myc antibody</td>
			<td style="width:107px;">Cell Signaling</td>
			<td style="width:119px;">2272</td>
			<td style="width:167px;">Rabbit</td>
		</tr>
		<tr height="21">
			<td height="21" style="height:21px;width:216px;">Peptide</td>
			<td style="width:107px;">Genscipt</td>
			<td style="width:119px;"></td>
			<td>customize ordering</td>
		</tr>
		<tr height="42">
			<td height="42" style="height:42px;width:216px;">Precision Plus Protein Dual color Standarts</td>
			<td style="width:107px;">BioRad</td>
			<td style="width:119px;">161-0374</td>
			<td></td>
		</tr>
	</tbody>
</table>

detection of detergent-sensitive interactions between membrane proteins

Protein-protein etkileşimleri keşfetmek için bizim yetenek hücredeki düzenleme bağlantılarını anlama anahtarıdır. Ancak, protein-protein etkileşimler birçok durumda tespiti önemli deneysel sorunlar ile ilişkilidir. Özellikle, sıralama reseptörleri kez deterjan duyarlı moda co-immunoprecipitation bu proteinlerin kullanılamaz yapar, membran bölmeleri Lümen içinde onların protein kargo ile etkileşim. Sıralama reseptör sortilin GLUT4 membran proteinlerinin arasındaki zayıf luminal etkileşimlerin bir örnek olarak hizmet verebilir glikoz taşıyıcı için bağlama. Burada, sortilin ve GLUT4 arasındaki etkileşimi doğrulamak için hızlı, basit ve ucuz bir tahlil açıklayın. Bunun için biz tasarladık ve kimyasal potansiyel sortilin bağlama epitope GLUT4 luminal kısmında karşılık gelen myc öğesini peptid sentez. Tagged ile altı histidines Sortilin memeli hücrelerinde ifade ve kobalt boncuk kullanarak hücre lysates izole. Üstündeki immobilize Sortilin peptid çözüm farklı pH değerlerinde ile inkübe ve eluted malzeme Western Blot tarafından analiz edildi. Bu tahlil diğer deterjan duyarlı protein-protein etkileşimleri çalışmaya kolayca adapte edilebilir.

Lysates 3T3 L1 hücreleri stabil Sortilin-myc/O'nun5 ve WT 3T3 L1 hücreleri, bir negatif kontrol kullanılan transfected hazırlanmıştır. Her iki lysates kobalt boncuk pH 6 veya pH 8 ile inkübe edildi ve iyice yıkanır. Boncuk immobilize proteinler ile sonra Myc-fll-Glut4 çözümünde inkübe. Dikkatli yıkamadan sonra boncuk için bağlı proteinler 0.25 M Imidazole ile eluted. Örnekleri tabi, SDS-sayfaya degrade jel takip her ikisi de tespiti için sortil...

Watch this Scientific Journal Video about Detection of Detergent-sensitive Interactions Between Membrane Proteins at JoVE.com

Detection of Detergent-sensitive Interactions Between Membrane Proteins

Biz algılama deterjan-duyarlı sıralama reseptör, sortilin, GLUT4, glukoz taşıyıcı protein ilk luminal döngü için bağlama örnek olarak kullanarak zar proteinleri arasında bir köprü işlevi için bir iletişim kuralı tanımlamak.

Membran proteinlerinin Hofstede deterjan duyarlı tespiti

Our ability to explore protein-protein interactions is the key to understanding regulatory connections in the cell. However, detection of protein-protein ...

detection-detergent-sensitive-interactions-between-membrane

Research

JoVE Journal

Biochemistry

5.9K Görüntüleme.  Boston University School of Medicine. Biz algılama deterjan-duyarlı sıralama reseptör, sortilin, GLUT4, glukoz taşıyıcı protein ilk luminal döngü için bağlama örnek olarak kullanarak zar proteinleri arasında bir köprü işlevi için bir iletişim kuralı tanımlamak.

Video: Detection of Detergent-sensitive Interactions Between Membrane Proteins

Using Scaffold Liposomes to Reconstitute Lipid-proximal Protein-protein Interactions In Vitro

Studies of integral membrane proteins in vitro are frequently complicated by the presence of a hydrophobic transmembrane domain. Further complicating these studies, reincorporation of detergent-solubilized membrane proteins into liposomes is a stochastic process where protein topology is impossible to enforce. This paper offers an alternative method to these challenging techniques that utilizes a liposome-based scaffold. Protein solubility is enhanced by deletion of the transmembrane domain, and these amino acids are replaced with a tethering moiety, such as a His-tag. This tether interacts with an anchoring group (Ni2+ coordinated by nitrilotriacetic acid (NTA(Ni2+)) for His-tagged proteins), which enforces a uniform protein topology at the surface of the liposome. An example is presented wherein the interaction between Dynamin-related protein 1 (Drp1) with an integral membrane protein, Mitochondrial Fission Factor (Mff), was investigated using this scaffold liposome method. In this work, we have demonstrated the ability of Mff to efficiently recruit soluble Drp1 to the surface of liposomes, which stimulated its GTPase activity. Moreover, Drp1 was able to tubulate the Mff-decorated lipid template in the presence of specific lipids. This example demonstrates the effectiveness of scaffold liposomes using structural and functional assays and highlights the role of Mff in regulating Drp1 activity.

Using Scaffold Liposomes to Reconstitute Lipid-proximal Protein-protein Interactions In Vitro

This paper describes a method for assessing the interactions and assemblies of integral membrane proteins in vitro with various partner factors in a lipid-proximal environment.

İskele Lipozomlar kullanarak Lipid-proksimal protein-protein etkileşimleri Sulandırın için<em&gt; İn Vitro</em

Studies of integral membrane proteins in vitro are frequently complicated by the presence of a hydrophobic transmembrane domain. Further complicating ...

Biyokimya

Method to Visualize and Analyze Membrane Interacting Proteins by Transmission Electron Microscopy

Monotopic proteins exert their function when attached to a membrane surface, and such interactions depend on the specific lipid composition and on the availability of enough area to perform the function. Nanodiscs are used to provide a membrane surface of controlled size and lipid content. In the absence of bound extrinsic proteins, sodium phosphotungstate-stained nanodiscs appear as stacks of coins when viewed from the side by transmission electron microscopy (TEM). This protocol is therefore designed to intentionally promote stacking; consequently, the prevention of stacking can be interpreted as the binding of the membrane-binding protein to the nanodisc. In a further step, the TEM images of the protein-nanodisc complexes can be processed with standard single-particle methods to yield low-resolution structures as a basis for higher resolution cryoEM work. Furthermore, the nanodiscs provide samples suitable for either TEM or non-denaturing gel electrophoresis. To illustrate the method, Ca2+-induced binding of 5-lipoxygenase on nanodiscs is presented.

Many proteins perform their function when attached to membrane surfaces. The binding of extrinsic proteins on nanodisc membranes can be indirectly imaged by transmission electron microscopy. We show that the characteristic stacking (rouleau) of nanodiscs induced by the negative stain sodium phosphotungstate is prevented by the binding of extrinsic protein.

Yöntem gözünüzde canlandırın ve Transmisyon Elektron Mikroskobu Membran Etkileşen Proteinler Analiz için

Monotopic proteins exert their function when attached to a membrane surface, and such interactions depend on the specific lipid composition and on the ...

Extracellular Protein Microarray Technology for High Throughput Detection of Low Affinity Receptor-Ligand Interactions

Secreted factors, membrane-tethered receptors, and their interacting partners are main regulators of cellular communication and initiation of signaling cascades during homeostasis and disease, and as such represent prime therapeutic targets. Despite their relevance, these interaction networks remain significantly underrepresented in current databases; therefore, most extracellular proteins have no documented binding partner. This discrepancy is primarily due to the challenges associated with the study of the extracellular proteins, including expression of functional proteins, and the weak, low affinity, protein interactions often established between cell surface receptors. The purpose of this method is to describe the printing of a library of extracellular proteins in a microarray format for screening of protein-protein interactions. To enable detection of weak interactions, a method based on multimerization of the query protein under study is described. Coupled to this microbead-based multimerization approach for increased multivalency, the protein microarray allows robust detection of transient protein-protein interactions in high throughput. This method offers a rapid and low sample consuming-approach for identification of new interactions applicable to any extracellular protein. Protein microarray printing and screening protocol are described. This technology will be useful for investigators seeking a robust method for discovery of protein interactions in the extracellular space.

Here, we present a protocol to screen extracellular protein microarrays for identification of novel receptor-ligand interactions in high throughput. We also describe a method to enhance detection of transient protein-protein interactions by using protein-microbead complexes.

Hücre dışı Protein Mikroarray teknoloji yüksek işlem hacmi düşük benzeşme reseptör-Ligand etkileşimleri algılanması için

Secreted factors, membrane-tethered receptors, and their interacting partners are main regulators of cellular communication and initiation of signaling ...

A Fluorescence Fluctuation Spectroscopy Assay of Protein-Protein Interactions at Cell-Cell Contacts

A variety of biological processes involves cell-cell interactions, typically mediated by proteins that interact at the interface between neighboring cells. Of interest, only few assays are capable of specifically probing such interactions directly in living cells. Here, we present an assay to measure the binding of proteins expressed at the surfaces of neighboring cells, at cell-cell contacts. This assay consists of two steps: mixing of cells expressing the proteins of interest fused to different fluorescent proteins, followed by fluorescence fluctuation spectroscopy measurements at cell-cell contacts using a confocal laser scanning microscope. We demonstrate the feasibility of this assay in a biologically relevant context by measuring the interactions of the amyloid precursor-like protein 1 (APLP1) across cell-cell junctions. We provide detailed protocols on the data acquisition using fluorescence-based techniques (scanning fluorescence cross-correlation spectroscopy, cross-correlation number and brightness analysis) and the required instrument calibrations. Further, we discuss critical steps in the data analysis and how to identify and correct external, spurious signal variations, such as those due to photobleaching or cell movement.
In general, the presented assay is applicable to any homo- or heterotypic protein-protein interaction at cell-cell contacts, between cells of the same or different types and can be implemented on a commercial confocal laser scanning microscope. An important requirement is the stability of the system, which needs to be sufficient to probe diffusive dynamics of the proteins of interest over several minutes.

This protocol describes a fluorescence fluctuation spectroscopy-based approach to investigate interactions among proteins mediating cell-cell interactions, i.e. proteins localized in cell junctions, directly in living cells. We provide detailed guidelines on instrument calibration, data acquisition and analysis, including corrections to possible artefact sources.

Bir floresan dalgalanma spektroskopisi tahlil Protein-Protein etkileşimlerinin hücre-hücre kişiler

A variety of biological processes involves cell-cell interactions, typically mediated by proteins that interact at the interface between neighboring ...

Evaluation of Protein&#8211;Protein Interactions using an On-Membrane Digestion Technique

Numerous intracellular proteins physically interact in accordance with their intracellular and extracellular circumstances. Indeed, cellular functions largely depend on intracellular protein&#8211;protein interactions. Therefore, research regarding these interactions is indispensable to facilitating the understanding of physiologic processes. Co-precipitation of associated proteins, followed by mass spectrometry (MS) analysis, enables the identification of novel protein interactions. In this study, we have provided details of the novel technique of immunoprecipitation-liquid chromatography (LC)-MS/MS analysis combined with on-membrane digestion for the analysis of protein&#8211;protein interactions. This technique is suitable for crude immunoprecipitants and can improve the throughput of proteomic analyses. Tagged recombinant proteins were precipitated using specific antibodies; next, immunoprecipitants blotted onto polyvinylidene difluoride membrane pieces were subjected to reductive alkylation. Following trypsinization, the digested protein residues were analyzed using LC-MS/MS. Using this technique, we were able to identify several candidate associated proteins. Thus, this method is convenient and useful for the characterization of novel protein&#8211;protein interactions.

Here, we present a protocol for an on-membrane digestion technique for the preparation of samples for mass spectrometry. This technique facilitates the convenient analysis of protein&#8211;protein interactions.

Bir on-membran sindirim tekniği kullanılarak protein-protein etkileşimlerinin değerlendirilmesi

Numerous intracellular proteins physically interact in accordance with their intracellular and extracellular circumstances. Indeed, cellular functions ...

Interactions with and Membrane Permeabilization of Brain Mitochondria by Amyloid Fibrils

A growing body of evidence indicates that membrane permeabilization, including internal membranes such as mitochondria, is a common feature and primary mechanism of amyloid aggregate-induced toxicity in neurodegenerative diseases. However, most reports describing the mechanisms of membrane disruption are based on phospholipid model systems, and studies directly targeting events occurring at the level of biological membranes are rare. Described here is a model for studying the mechanisms of amyloid toxicity at the membrane level. For mitochondrial isolation, density gradient medium is used to obtain preparations with minimal myelin contamination. After mitochondrial membrane integrity confirmation, the interaction of amyloid fibrils arising from &#945;-synuclein, bovine insulin, and hen egg white lysozyme (HEWL) with rat brain mitochondria, as an in vitro biological model, is investigated. The results demonstrate that treatment of brain mitochondria with fibrillar assemblies can cause different degrees of membrane permeabilization and ROS content enhancement. This indicates structure-dependent interactions between amyloid fibrils and mitochondrial membrane. It is suggested that biophysical properties of amyloid fibrils and their specific binding to mitochondrial membranes may provide explanations for some of these observations.

Provided here is a protocol for investigating the interactions between native form, prefibrillar, and mature amyloid fibrils of different peptides and proteins with mitochondria isolated from different tissues and various areas of the brain.

Amiloid Fibrils ile Beyin Mitokondrisi ile Etkileşimler ve Membran Permeabilizasyonu

A growing body of evidence indicates that membrane permeabilization, including internal membranes such as mitochondria, is a common feature and primary ...

Acyl-PEGyl Exchange Gel Shift Assay for Quantitative Determination of Palmitoylation of Brain Membrane Proteins

Activity-dependent alterations in the levels of synaptic AMPA receptors (AMPARs) within the postsynaptic density (PSD) is thought to represent a cellular mechanism for learning and memory. Palmitoylation regulates localization and function of many synaptic proteins including AMPA-Rs, auxiliary factors and synaptic scaffolds in an activity-dependent manner. We identified the synapse differentiation induced gene (SynDIG) family of four genes (SynDIG1-4) encoding brain-specific transmembrane proteins that associate with AMPARs and regulate synapse strength. SynDIG1 is palmitoylated at two cysteine residues located at positions 191 and 192 in the juxta-transmembrane region important for activity-dependent excitatory synapse development. Here, we describe an innovative biochemical approach, the acyl-PEGyl exchange gel shift (APEGS) assay, to investigate the palmitoylation state of any protein of interest and demonstrate its utility with the SynDIG family of proteins in mouse brain lysates.

Palmitoylation entails the incorporation of a 16-carbon palmitate moiety to cysteine residues of target proteins in a reversible manner. Here, we describe a biochemical approach, the acyl-PEGyl exchange gel shift (APEGS) assay, to investigate the palmitoylation state of any protein of interest in mouse brain lysates.

Beyin Zarı Proteinlerinin Palmitoylarasyonunun Kantitatif Tayini için Acyl-PEGyl Exchange Jel Shift Tayini

Activity-dependent alterations in the levels of synaptic AMPA receptors (AMPARs) within the postsynaptic density (PSD) is thought to represent a cellular ...

Measuring Nucleotide Binding to Intact, Functional Membrane Proteins in Real Time

We have developed a method to measure binding of adenine nucleotides to intact, functional transmembrane receptors in a cellular or membrane environment. This method combines expression of proteins tagged with the fluorescent non-canonical amino acid ANAP, and FRET between ANAP and fluorescent (trinitrophenyl) nucleotide derivatives. We present examples of nucleotide binding to ANAP-tagged KATP ion channels measured in unroofed plasma membranes and excised, inside-out membrane patches under voltage clamp. The latter allows for simultaneous measurements of ligand binding and channel current, a direct readout of protein function. Data treatment and analysis are discussed extensively, along with potential pitfalls and artefacts. This method provides rich mechanistic insights into the ligand-dependent gating of KATP channels and can readily be adapted to the study of other nucleotide-regulated proteins or any receptor for which a suitable fluorescent ligand can be identified.

This protocol presents a method for measuring adenine nucleotide binding to receptors in real time in a cellular environment. Binding is measured as F&#246;rster resonance energy transfer (FRET) between trinitrophenyl nucleotide derivatives and protein labeled with a non-canonical, fluorescent amino acid.

Sağlam, fonksiyonel membran proteinlerine bağlanan nükleotidin gerçek zamanlı olarak ölçülmesi

We have developed a method to measure binding of adenine nucleotides to intact, functional transmembrane receptors in a cellular or membrane environment. ...

Transverse Sectioning of Mature Rice (Oryza sativa L.) Kernels for Scanning Electron Microscopy Imaging Using Pipette Tips as Immobilization Support

Starch granules (SGs) exhibit different morphologies depending on the plant species, especially in the endosperm of the Poaceae family. Endosperm phenotyping can be used to classify genotypes based on SG morphotype using scanning electron microscopic (SEM) analysis. SGs can be visualized using SEM by slicing through the kernel (pericarp, aleurone layers, and endosperm) and exposing the organellar contents. Current methods require the rice kernel to be embedded in plastic resin and sectioned using a microtome or embedded in a truncated pipette tip and sectioned by hand using a razor blade. The former method requires specialized equipment and is time-consuming, while the latter introduces a new host of problems depending on rice genotype. Chalky rice varieties, particularly, pose a problem for this type of sectioning due to the friable nature of their endosperm tissue. Presented here is a technique for preparing translucent and chalky rice kernel sections for microscopy, requiring only pipette tips and a scalpel blade. Preparing the sections within the confines of a pipette tip prevents rice kernel endosperm from shattering (for translucent or &#8216;vitreous&#8217; phenotypes) and crumbling (for chalky phenotypes). Using this technique, endosperm cell patterning and the structure of intact SGs can be observed.

Transverse Sectioning of Mature Rice Oryza sativa L. Kernels for Scanning Electron Microscopy Imaging Using Pipette Tips as Immobilization Support

This protocol allows for the preparation of transverse sections of cereal seeds (e.g., rice) for the analysis of endosperm and starch granule morphology using scanning electron microscopy.

Olgun Pirincin Enine Kesiti (Oryza sativa L.) Hareketsizleştirme Desteği Olarak Pipet İpuçlarını Kullanarak Elektron Mikroskopi Görüntülemesini Taramak için Çekirdekler

Starch granules (SGs) exhibit different morphologies depending on the plant species, especially in the endosperm of the Poaceae family. Endosperm ...

Co-Translational Insertion of Membrane Proteins into Preformed Nanodiscs

Cell-free expression systems allow the tailored design of reaction environments to support the functional folding of even complex proteins such as membrane proteins. The experimental procedures for the co-translational insertion and folding of membrane proteins into preformed and defined membranes supplied as nanodiscs are demonstrated. The protocol is completely detergent-free and can generate milligrams of purified samples within one day. The resulting membrane protein/nanodisc samples can be used for a variety of functional studies and structural applications such as crystallization, nuclear magnetic resonance, or electron microscopy. The preparation of basic key components such as cell-free lysates, nanodiscs with designed membranes, critical stock solutions as well as the assembly of two-compartment cell-free expression reactions is described. Since folding requirements of membrane proteins can be highly diverse, a major focus of this protocol is the modulation of parameters and reaction steps important for sample quality such as critical basic reaction compounds, membrane composition of nanodiscs, redox and chaperone environment, or DNA template design. The whole process is demonstrated with the synthesis of proteorhodopsin and a G-protein coupled receptor.

Co-translational insertion into pre-formed nanodiscs makes it possible to study cell-free synthesized membrane proteins in defined lipid environments without contact with detergents. This protocol describes the preparation of essential system components and the critical parameters for improving expression efficiency and sample quality.

Membran proteinlerinin Hofstede deterjan duyarlı tespiti

Özet

Daha Fazla Video Keşfet

Bu videodaki bölümler

İskele Lipozomlar kullanarak Lipid-proksimal protein-protein etkileşimleri Sulandırın için