Name: detection of detergent-sensitive interactions between membrane proteins
Uploaded: 2018-03-07T14:45:00.000+00:00
Duration: 10 min 9 s
Description: Watch this Scientific Journal Video about Detection of Detergent-sensitive Interactions Between Membrane Proteins at JoVE.com

Bu eser DK52057 ve K.V.K. X.P için gelen NIH DK107498 kurumsal eğitim grant 2T32DK007201 NIH üzerinden tarafından desteklenen araştırma hibe tarafından desteklenmiştir.

1. peptid işlenmesi
<ol><li>Tasarım ve peptid sipariş<ol>
<li>Peptid istenen sırayı seçin ve myc epitope (EQKLISEED), onun ya da N - veya C-terminus gibi bir etiket ekleyin.</li>
		<li>Peptid suda peptid çözünürlük hesap makinesi http://pepcalc.com/peptide-solubility-calculator.php kullanarak tahmin edilen çözünürlük kontrol edin. Çözünürlük düşük ise, şarj dengeyi değiştirmek için başka bir suda çözünen etiket eklemeyi deneyin. Not: Biz N terminus (Myc-fll-GLUT4) ilk luminal döngü (fll) için myc epitope (kalın yazı tipi) ile öğesini GLUT4, karşılık gelen peptid kullanılır: "iyi" tahmin edilen suda var EQKLISEEDLNAPQKVIEQSYNATWLGRQGPGGPSSIPPGTLTTLWA .</li>
		<li>En az % 75 ile özel peptid sipariş saflık tahlil için yeterli olan ve çözünürlük testi için sağlayıcınıza danışın. Sipariş peptid eriterek ile beklenmedik sorunlar durumunda en az iki aliquots ayrı. Not: Myc-fll-GLUT4 iki aliquots emri verildi. Ultrasaf suda bildirilen onun ≤10 mg/mL'dir.</li>
	</ol>
</li>
	<li>Peptid eriterek Not: En iyi solvent ultrasaf su var. Peptid suda çözünür olmak görünmüyorsa yönergeler için http://www.genscript.com/peptide_solubility_and_stablity.html bakın.<ol>
<li>100 x peptid ultrasaf su veya 100 μg/mL konsantrasyonu ile seçim, arabellek çalışma çözüm hazırlamak.</li>
		<li>50-100 µL aliquots belgili tanımlık eriyik ayırmak ve onları-20 ° C'de depolayın</li>
	</ol>
</li>
</ol>2. hücre işleme
<ol><li>Hücre kültürü<ol>
<li>Vahşi türü (WT) hücreleri bir negatif kontrol ve altı histidines (HISP) ile öğesini hedef protein ifade hücreleri olarak kullanın. Not: Biz 3T3 L1 ön adiposit stabil Sortilin-myc/O'nun5ile transfected kullanılır.</li>
		<li>Dulbecco'nın modifiye kartal orta (DMEM) yüksek şeker % 10 buzağı sığır serum ile desteklenmiş, hücrelerin büyümesine glutamin (2 mM) ve penisilin/streptomisin (5 μg/mL) % 10 CO237 ° C'de.</li>
		<li>Dört 10 cm yemekleri hücre oturup iki tane HISP ile transfect ve diğer iki denetim plazmid (WT) ile transfect. 48 h transfection sonra hücrelerin % 80-90 confluency ulaştırılması gerekmektedir.</li>
	</ol>
</li>
	<li>Hücre Lysates hazırlanması<ol>
<li>Lizis arabellek (10 mM Hepes, 30 mM NaCl, %5 gliserol, 10 mM Imidazole, % 0.5 Triton X-100 ve proteaz inhibitörü EDTA kokteyl O'nun öğesini proteinler, pH 7.4 yalıtımı için) hazırlamak ve 4'te tutmak ° c</li>
		<li>Hücreleri üç kez 10 mL 1 x fosfat tamponlu tuz (PBS) 4 ° C'de yıkama</li>
		<li>Bulaşıkları buza koy ve 500 µL lizis arabelleği her yemek için ekleyin. Bir hücre kazıyıcı kullanarak hücre lysates hasat.</li>
		<li>Lysate her yemeğin farklı 1,5 mL tüp içine yerleştirin. Tüpler WT-pH6, WT-pH8, HISP-pH6, HISP-pH8 olarak etiketleyin.</li>
		<li>Hücre lysates bir şırınga ile 26 G iğne ile beş kez yukarı ve aşağı, tam lizis için geçmek.</li>
		<li>Hücre lysates, 16.000 x g 4 ° C'de 10 dakika santrifüj kapasitesi</li>
		<li>Supernatants yeni aynı şekilde etiketlenmiş tüpler aktarın.</li>
		<li>Protein konsantrasyonu BCA Protein tahlil seti veya diğer seti kullanarak analiz.</li>
		<li>Lizis arabellek kullanarak, tüm dört lysates protein konsantrasyonu eşitlemek.</li>
		<li>Bir küçük (ca. 20 µL) aliquot, her lysate ayrı ve olası kontrol deneyleri ve/veya sorun çekim için-20 ° C'de tutun.</li>
	</ol>
</li>
</ol>3. HisPur kobalt boncuk için O'nun öğesini proteinlerin bağlama
<ol><li>Piyasada bulunan yıkama arabellek kullanın veya bir (50 mM Na2HPO4/NaH2PO4, 300 mM NaCl, 20 mM imidazole, pH 8) hazırlamak ve 4 ° C'de tutmak</li>
	<li>Yıkama hazırlamak pH 6 tarafından tittering yıkama tampon pH 8 ile birlikte tut HCl. bu 4 ° C'de tampon</li>
	<li>Yavaşça homojen süspansiyon yapmak kobalt boncuk şişe girdap.</li>
	<li>Kobalt boncuk süspansiyon 40 µL yukarıdaki gibi işaretlenmiş dört 1,5 mL tüpler içine (Adım 2.2.4) dağıtmak.</li>
	<li>1 mL lizis arabellek her tüp için ekleyin ve 5 s. aspiratı süpernatant için 1000 x g de tüpler santrifüj kapasitesi ve 40 μL lizis arabelleği için kapatılan boncuk ekleyin.</li>
	<li>Hücre lysates karşılık gelen borular için ekleyin.</li>
	<li>Tüpler için 90 dk 4 ° c 20 d/d tüp rotator üzerinde kuluçkaya.</li>
	<li>Tüpler santrifüj kapasitesi 1000 x g 5 s ve süpernatant toplamak için. 4 ° C'de süpernatant tutmak</li>
	<li>PH 8 veya pH 6 yıkama arabellek 500 µL karşılık gelen borular için ekleyin ve boncuk hafifçe yeniden askıya alma.</li>
	<li>1000 x g 5 s ve atmak için de tüpler santrifüj kapasitesi supernatants.</li>
	<li>Adım 3,9 ve 3.10 için dört kez tekrarlayın.</li>
</ol>4. peptid üstündeki immobilize O'nun öğesini Protein için bağlama
<ol><li>Peptid (1.2.1. adım) 100 x çalışma çözümü kullanarak 1 çalışma çözümler pH 6 veya pH 8 yıkama arabellek (her iki 100 µL aliquots, 1 µg/mL) x hazırlamak.</li>
	<li>1 x peptid çözeltinin 100 μL karşılık gelen pH ile yıkanmış boncuk ekleyin.</li>
	<li>Boncuk 20 rpm bir tüp rotator üzerinde 4 ° C'de 30 dk için kuluçkaya.</li>
	<li>1000 x g 5 için de tüpler santrifüj kapasitesi s, süpernatant toplamak ve -20 ° C'de tutmak</li>
	<li>Adım 3,9 ve 3.10 için dört kez tekrarlayın. Not: olası arka plan azaltmak için aşağıdaki adımları adımları 4.4 & 4.5 yerini alabilir.</li>
	<li>Onları olduğu gibi adım 2.2.4 etiket ve sütunları koleksiyon tüplerde yer 30 mikron gözenekleri dört mikro sütunlarla alın.</li>
	<li>Sütunlara kuluçka karışımı adım 4.3, tamamlanması aktardıktan sonra çözüm yerçekimi tarafından geçmesine izin verin. -20 ° C'de aracılığıyla akış devam</li>
	<li>Yıkama tamponunun pH 6 veya pH 8 karşılık gelen sütunları aracılığıyla ile 500 µL yerçekimi tarafından geçmek. Aracılığıyla akış atmak.</li>
	<li>Adımı yineleyin 4,8 dört kez.</li>
	<li>Son yıkama sonra santrifüj kapasitesi 1000 x g 15 sütun s.</li>
</ol>5. elüsyon kobalt boncuk üzerinden
<ol><li>Kullanım ticari Tricine örnek arabellek (200 mM Tris-HCl, % 40 gliserol, % 2 SDS, %0,04 Coomassie mavi, pH 6.8) ve β-mercaptoethanol % 2 son konsantrasyonu ekleyin.</li>
	<li>Tricine örnek arabelleği (β-mercaptoethanol ile) 40 µL yıkanmış boncuk ve girdap örnek ekleyin.</li>
	<li>Örnekleri 100 ° C'de 10 dakika için ısı girdap örnekleri daha ve 1000 x g 5 için de tüpler santrifüj kapasitesi s. Not: elüsyon olası nonspesifik bağlama azaltmak için aşağıdaki adımları adımları 5.1-5,3 yerini alabilir.</li>
	<li>40 μL elüsyon Imidazole arabelleği (50 mM Na2HPO4/NaH2PO4, 300 mM NaCl, 0.25 M imidazole) yıkanmış için eklemek boncuk, girdap ve tüpler, oda sıcaklığında 20 dk için kuluçkaya.</li>
	<li>3000 x g 30 de tüpler santrifüj kapasitesi s, süpernatant (eluted örnekleri) toplamak ve yeni etiketli tüpler için transfer.</li>
	<li>Tricine örnek arabelleği 40 μL her tüp eklemek, örnekleri 10 dk 100 ° C, girdap ve santrifüj için ısı tüpler 1000 x g 5 için de s. Not: mikro sütun kullanılıyorsa, elüsyon arabellek için yıkanmış boncuklar, eklemek için 20 dk kuluçkaya ve 8.000 x g 2 min için de Santrifüjü tarafından elüsyon toplamak. Not: Elektroforez gerçekleştirilir kadar örnekleri-20 ° C'de tutulabilir.</li>
</ol>6. Elektroforez ve Western Blot
Not: Örnekleri SDS-sayfa ve sonraki Western Blot tarafından ayrılması için hazırsınız demektir. Jel Elektroforez (https://www.jove.com/science-education/5065/the-western-blot) aşağıdaki değişiklikler ile protokolünden izleyin.
<ol><li>Piyasada bulunan 10-%20 Tricine degrade jelleri kullanın.</li>
	<li>Üzerinde jel, eluted örnekleri 20 µL ve lysates (Adım 2.2.10) 20 µL yük. Sorun çekim için bu 20 µL ilişkisiz malzeme (Adım 3.8) yüklemek için tavsiye edilir ve 10 ng peptid; yükleme önce bu örnekler için Tricine örnek arabellek eşit miktarda ekleyin.</li>
	<li>Elektroforez ticari Tris/Tricine/SDS arabellek (100 mM Tris, 100 mM Tricine ve % 0.1 SDS, pH 8.3) çalıştıran içinde yerine getirir.</li>
	<li>Malzeme % 20 metanol ile desteklenen Aktarım arabellek (25 mM Tris Bankası, 192 mM glisin, pH 8.4) kullanarak 0,45 µm nitroselüloz membran üzerine jel transfer.</li>
	<li>Membran ile % 3 blok sığır Serum Albumin (BSA) oda sıcaklığında 1 h için. Önceden lekeli molekül ağırlığı işaretçileri kılavuz olarak kullanarak, membran yatay kesme, HISP karşı antikor ile üst kısmında leke ve alt kısmında bir antikor myc öğesini peptid tanımlamak için myc epitope karşı ile leke. Not: HISP ve Myc-fll-GLUT4 bir anti-myc antikor ile tespit edilebilir beri bizim durumda, membran kesme gerekli değildir.</li>
</ol>7. analiz sonuçları
<ol><li>Bir görüntü istasyonu veya ImageJ programı kullanarak tüm Western blot sinyalleri yoğunluğunu ölçmek.</li>
	<li>Myc öğesini peptid HISP sinyalini her iki pH değerlerinde karşı gelen sinyal normalleştirmek.</li>
</ol>

<ol>
	<li>Bogan, J. S. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Regulation+of+glucose+transporter+translocation+in+health+and+diabetes.">Regulation of glucose transporter translocation in health and diabetes.</a> Annu Rev Biochem. 81, 507-532 (2012).</li><li>Kandror, K. V., Pilch, P. F. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+sugar+is+sIRVed:+sorting+Glut4+and+its+fellow+travelers.">The sugar is sIRVed: sorting Glut4 and its fellow travelers.</a> Traffic. 12 (6), 665-671 (2011).</li><li>Pan, X., Zaarur, N., Singh, M., Morin, P., Kandror, K. V. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Sortilin+and+retromer+mediate+retrograde+transport+of+Glut4+in+3T3-L1+adipocytes.">Sortilin and retromer mediate retrograde transport of Glut4 in 3T3-L1 adipocytes.</a> Mol Biol Cell. 28 (12), 1667-1675 (2017).</li><li>Kim, J., Kandror, K. V. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+first+luminal+loop+confers+insulin+responsiveness+to+the+glucose+transporter+4.">The first luminal loop confers insulin responsiveness to the glucose transporter 4.</a> Mol Biol Cell. 23 (5), 910-917 (2012).</li><li>Shi, J., Kandror, K. V. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Sortilin+is+essential+and+sufficient+for+the+formation+of+Glut4-storage+vesicles+in+3T3-L1+adipocytes.">Sortilin is essential and sufficient for the formation of Glut4-storage vesicles in 3T3-L1 adipocytes.</a> Dev Cell. 9 (1), 99-108 (2005).</li><li>Coutinho, M. F., Prata, M. J., Alves, S. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=A+shortcut+to+the+lysosome:+the+mannose-6-phosphate-independent+pathway.">A shortcut to the lysosome: the mannose-6-phosphate-independent pathway.</a> Mol Genet Metab. 107 (3), 257-266 (2012).</li><li>Willnow, T. E., Petersen, C. M., Nykjaer, A. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=VPS10P-domain+receptors+-+regulators+of+neuronal+viability+and+function.">VPS10P-domain receptors - regulators of neuronal viability and function.</a> Nat Rev Neurosci. 9 (12), 899-909 (2008).</li><li>Mazella, J., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+100-kDa+neurotensin+receptor+is+gp95/sortilin,+a+non-G-protein-coupled+receptor.">The 100-kDa neurotensin receptor is gp95/sortilin, a non-G-protein-coupled receptor.</a> J Biol Chem. 273 (41), 26273-26276 (1998).</li><li>Ni, X., Morales, C. R. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+Lysosomal+Trafficking+of+Acid+Sphingomyelinase+is+Mediated+by+Sortilin+and+Mannose+6-phosphate+Receptor.">The Lysosomal Trafficking of Acid Sphingomyelinase is Mediated by Sortilin and Mannose 6-phosphate Receptor.</a> Traffic. 7 (7), 889-902 (2006).</li><li>Westergaard, U. B., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Functional+organization+of+the+sortilin+Vps10p+domain.">Functional organization of the sortilin Vps10p domain.</a> J Biol Chem. 279 (48), 50221-50229 (2004).</li><li>Nykjaer, A., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Sortilin+is+essential+for+proNGF-induced+neuronal+cell+death.">Sortilin is essential for proNGF-induced neuronal cell death.</a> Nature. 427 (6977), 843-848 (2004).</li></ol>

Yazarlar ifşa gerek yok.

Sortilin her iki sinyal plazma zarı ve hücre içi sıralama olaylar6,7dahil bir evrimsel korunmuş çok ligand protein reseptörü var. Ancak, deterjanlar için duyarlı olmak sortilin etkileşim bazı bağlama ortakları ile göründüğü gibi otantik sortilin'ın ligandlar (bazıları luminal veya integral membran proteinlerinin olan) için arama karmaşıktır. Bu nedenle, bir kolay ve protein-protein etkileşimleri, türleri çalışmak için yaygın bir y...

GLUT4 nerede insülin etkisi sonrası prandial kan glikoz izni1aracılık eder yağ ve kas hücrelerinde ağırlıklı olarak gösterilen bir glikoz taşıyıcı proteindir. Çok istikrarlı bir protein olmak, GLUT4 translasyon düzeyinde düzenlenir. İnsülin yokluğunda GLUT4 büyük ölçüde plazma membran (dolayısıyla düşük Bazal geçirgenliği glikoz için) gelen söz konusu değildir ve küçük insülin duyarlı veziküller (IRVs) hücre içinde ağırlıklı olarak yerelleştirilmiştir ve temsil etmek büyük olasılıkla trans-Golgi ağ (TGN) Irv donör bölüm. İnsülin yönetim, üzerine IRVs plazma zarı ile sigorta ve işleyişi siteye GLUT4 teslim. Bu glikoz alımı adiposit ve iskelet miyositler kandan 10'a 40-fold yükselir böylece bu glikoz, plazma membran geçirgenliği artar. İnsülin çekilme sonra GLUT4 erken/sıralama endosomes içselleştirilmiş ve IRVs yeniden kurulan nerede TGN alındı. Her iki sıralama adımlar GLUT4 yolu, Yani çevresel erken endosomes tarafından ulaşım perinükleer TGN için ve IRVs oluşumu üzerinde membranlar Vps10p aile üyesi tarafından bir türü temsil eden sortilin, etkin TGN donör ben transmembran protein ve sıralama reseptör. Bir modeline göre sortilin bir transmembran iskele protein çalışır: GLUT4 endosomes ve TGN Lümen bağlar ve onun C-terminus2, retromer veya clathrin adaptörler donör membran aracılığıyla sitoplazmik tarafına acemi 3. bu GLUT4 dağıtım GLUT4 hücre içi bölmeleri arasında translocate veziküler taşıyıcıları içine kolaylaştırır.
Sortilin sitoplazmik kuyruk retromer ve çeşitli adaptör proteinler ile etkileşim iyi belgelenmiş oldu. Ancak, sortilin GLUT4 (ve onun diğer protein ligandlar birkaç) bağlantısını kanıtlamak için zor oldu. Özellikle, co-immunoprecipitate sortilin ve GLUT4 girişimlerini muhtemelen bu iki proteinler arasındaki etkileşimi deterjan duyarlı olması nedeniyle başarılı olmamıştır. Ayrıca, bir tipik taşıyıcı protein olarak GLUT4 12 transmembran etki alanları ve 6 luminal döngüler hangi herhangi bir bileşimini potansiyel bir sortilin bağlama site temsil edebilir vardır. Aynı zamanda, membran geçirgen DSP ve etkileşim ile Maya iki hibrid sistemde cross-linking önemli ortak yerelleştirme hücresinde, gibi dolaylı kanıtların büyük bir vücut önermek o sortilin GLUT4 için bağlayabilirsiniz. Ayrıca, ikinci yaklaşımı mutagenesis tarama alanin ile bir arada kullanarak, biz daha önce sortilin Vps10p etki öncelikle GLUT4 ilk luminal döngüsünü için bağlar belirledik. Ancak, böyle bir etkileşim memeli hücreleri olarak kanıtı kayıp olmuştur. Burada, asidik ortamda benzer O'nun öğesini sortilin kobalt reçine kullanarak ve kimyasal olarak sentezlenmiş peptid GLUT4 ilk luminal döngü pH 6 ve pH 8 karşılık gelen ile etkileşim kurabilir gösterdi transfected 3T3-L1 hücreleri izole ettim endosomal Lümen ve TGN membranlar nötr ortam Lümen içinde. Hiçbir peptid bağlama denetimi deneylerde nerede sigara transfected hücrelerden hazırlanan özü aynı boncuk dolu olduğunu tespit edilmiştir.

<table><tbody><tr><td>Protease inhibitor cocktail</td><td>Sigma</td><td>P8849</td><td>for use in purification of histidine tag protein</td></tr><tr><td>Phosphate-Buffered Saline&amp;nbsp;</td><td>Corning</td><td>21-040-CV</td><td>PBS</td></tr><tr><td>1mL Insulin Syringe U-100</td><td>BD</td><td>329652</td><td>26G x 1/2</td></tr><tr><td>BCA Protein Assay Kit</td><td>Pierce</td><td>23228</td><td></td></tr><tr><td>Wash buffer</td><td>Boston BioProducts</td><td>BP-234</td><td>For His-tag protein purification</td></tr><tr><td>HisPur Cobalt Resin</td><td>Thermo Scientific</td><td>89964</td><td></td></tr><tr><td>Tricine sample Buffer</td><td>Bio-Rad</td><td>161-0739</td><td>with SDS, bMercaptaethanol should be added</td></tr><tr><td>Elution&amp;nbsp; Buffer</td><td>Boston BioProducts</td><td>BP-236</td><td>For His-tag protein purificationwith 250mM Imidazole</td></tr><tr><td>Mini-Protean Tris-Tricine precast gels 10-20%&amp;nbsp;</td><td>Bio-Rad</td><td>456-3115</td><td>For seperation of peptide and small protein</td></tr><tr><td>Tris/Tricine/SDS running buffer&amp;nbsp;</td><td>Bio-Rad</td><td>161-0744</td><td></td></tr><tr><td>Transfer Buffer</td><td>Boston BioProducts</td><td>BP-190</td><td>Add 20% methanol</td></tr><tr><td>Nitrocellulose membrane&amp;nbsp; 0.45 mm</td><td>Bio-Rad</td><td>1620115</td><td></td></tr><tr><td>Bovine Serum Albumin</td><td>Sigma</td><td>A9647</td><td>BSA</td></tr><tr><td>Anti Myc antibody</td><td>Cell Signaling</td><td>2272</td><td>Rabbit</td></tr><tr><td>Peptide</td><td>Genscipt</td><td></td><td>customize ordering</td></tr><tr><td>Precision Plus Protein Dual color Standarts</td><td>BioRad</td><td>161-0374</td><td></td></tr></tbody></table>

detection of detergent-sensitive interactions between membrane proteins

Protein-protein etkileşimleri keşfetmek için bizim yetenek hücredeki düzenleme bağlantılarını anlama anahtarıdır. Ancak, protein-protein etkileşimler birçok durumda tespiti önemli deneysel sorunlar ile ilişkilidir. Özellikle, sıralama reseptörleri kez deterjan duyarlı moda co-immunoprecipitation bu proteinlerin kullanılamaz yapar, membran bölmeleri Lümen içinde onların protein kargo ile etkileşim. Sıralama reseptör sortilin GLUT4 membran proteinlerinin arasındaki zayıf luminal etkileşimlerin bir örnek olarak hizmet verebilir glikoz taşıyıcı için bağlama. Burada, sortilin ve GLUT4 arasındaki etkileşimi doğrulamak için hızlı, basit ve ucuz bir tahlil açıklayın. Bunun için biz tasarladık ve kimyasal potansiyel sortilin bağlama epitope GLUT4 luminal kısmında karşılık gelen myc öğesini peptid sentez. Tagged ile altı histidines Sortilin memeli hücrelerinde ifade ve kobalt boncuk kullanarak hücre lysates izole. Üstündeki immobilize Sortilin peptid çözüm farklı pH değerlerinde ile inkübe ve eluted malzeme Western Blot tarafından analiz edildi. Bu tahlil diğer deterjan duyarlı protein-protein etkileşimleri çalışmaya kolayca adapte edilebilir.

Lysates 3T3 L1 hücreleri stabil Sortilin-myc/O'nun5 ve WT 3T3 L1 hücreleri, bir negatif kontrol kullanılan transfected hazırlanmıştır. Her iki lysates kobalt boncuk pH 6 veya pH 8 ile inkübe edildi ve iyice yıkanır. Boncuk immobilize proteinler ile sonra Myc-fll-Glut4 çözümünde inkübe. Dikkatli yıkamadan sonra boncuk için bağlı proteinler 0.25 M Imidazole ile eluted. Örnekleri tabi, SDS-sayfaya degrade jel takip her ikisi de tespiti için sortil...

Watch this Scientific Journal Video about Detection of Detergent-sensitive Interactions Between Membrane Proteins at JoVE.com

Detection of Detergent-sensitive Interactions Between Membrane Proteins

Biz algılama deterjan-duyarlı sıralama reseptör, sortilin, GLUT4, glukoz taşıyıcı protein ilk luminal döngü için bağlama örnek olarak kullanarak zar proteinleri arasında bir köprü işlevi için bir iletişim kuralı tanımlamak.

Membran proteinlerinin Hofstede deterjan duyarlı tespiti

Our ability to explore protein-protein interactions is the key to understanding regulatory connections in the cell. However, detection of protein-protein ...

detection-detergent-sensitive-interactions-between-membrane

Research

JoVE Journal

Biochemistry

5.9K Görüntüleme.  Boston University School of Medicine. Biz algılama deterjan-duyarlı sıralama reseptör, sortilin, GLUT4, glukoz taşıyıcı protein ilk luminal döngü için bağlama örnek olarak kullanarak zar proteinleri arasında bir köprü işlevi için bir iletişim kuralı tanımlamak.

Video: Detection of Detergent-sensitive Interactions Between Membrane Proteins

Method to Visualize and Analyze Membrane Interacting Proteins by Transmission Electron Microscopy

Monotopic proteins exert their function when attached to a membrane surface, and such interactions depend on the specific lipid composition and on the availability of enough area to perform the function. Nanodiscs are used to provide a membrane surface of controlled size and lipid content. In the absence of bound extrinsic proteins, sodium phosphotungstate-stained nanodiscs appear as stacks of coins when viewed from the side by transmission electron microscopy (TEM). This protocol is therefore designed to intentionally promote stacking; consequently, the prevention of stacking can be interpreted as the binding of the membrane-binding protein to the nanodisc. In a further step, the TEM images of the protein-nanodisc complexes can be processed with standard single-particle methods to yield low-resolution structures as a basis for higher resolution cryoEM work. Furthermore, the nanodiscs provide samples suitable for either TEM or non-denaturing gel electrophoresis. To illustrate the method, Ca2+-induced binding of 5-lipoxygenase on nanodiscs is presented.

Many proteins perform their function when attached to membrane surfaces. The binding of extrinsic proteins on nanodisc membranes can be indirectly imaged by transmission electron microscopy. We show that the characteristic stacking (rouleau) of nanodiscs induced by the negative stain sodium phosphotungstate is prevented by the binding of extrinsic protein.

Yöntem gözünüzde canlandırın ve Transmisyon Elektron Mikroskobu Membran Etkileşen Proteinler Analiz için

Monotopic proteins exert their function when attached to a membrane surface, and such interactions depend on the specific lipid composition and on the ...

Biyokimya

Contrast-Matching Detergent in Small-Angle Neutron Scattering Experiments for Membrane Protein Structural Analysis and Ab Initio Modeling

The biological small-angle neutron scattering instrument at the High-Flux Isotope Reactor of Oak Ridge National Laboratory is dedicated to the investigation of biological materials, biofuel processing, and bio-inspired materials covering nanometer to micrometer length scales. The methods presented here for investigating physical properties (i.e., size and shape) of membrane proteins (here, MmIAP, an intramembrane aspartyl protease from Methanoculleus marisnigri) in solutions of micelle-forming detergents are well-suited for this small-angle neutron scattering instrument, among others. Other biophysical characterization techniques are hindered by their inability to address the detergent contributions in a protein-detergent complex structure. Additionally, access to the Bio-Deuteration Lab provides unique capabilities for preparing large-scale cultivations and expressing deuterium-labeled proteins for enhanced scattering signal from the protein. While this technique does not provide structural details at high-resolution, the structural knowledge gap for membrane proteins contains many addressable areas of research without requiring near-atomic resolution. For example, these areas include determination of oligomeric states, complex formation, conformational changes during perturbation, and folding/unfolding events. These investigations can be readily accomplished through applications of this method.

Contrast-Matching Detergent in Small-Angle Neutron Scattering Experiments for Membrane Protein Structural Analysis and Ab Initio Modeling

This protocol demonstrates how to obtain a low-resolution ab initio model and structural details of a detergent-solubilized membrane protein in solution using small-angle neutron scattering with contrast-matching of the detergent.

Kontrast eşleştirme deterjan küçük açı Nötron saçılma deneylerde membran proteini yapısal analiz ve Ab Initio modelleme

The biological small-angle neutron scattering instrument at the High-Flux Isotope Reactor of Oak Ridge National Laboratory is dedicated to the ...

Membrane-SPINE: A Biochemical Tool to Identify Protein-protein Interactions of Membrane Proteins In Vivo

Membrane proteins are essential for cell viability and are therefore important therapeutic targets1-3. Since they function in complexes4, methods to identify and characterize their interactions are necessary5. To this end, we developed the Membrane Strep-protein interaction experiment, called Membrane-SPINE6. This technique combines in vivo cross-linking using the reversible cross-linker formaldehyde with affinity purification of a Strep-tagged membrane bait protein. During the procedure, cross-linked prey proteins are co-purified with the membrane bait protein and subsequently separated by boiling. Hence, two major tasks can be executed when analyzing protein-protein interactions (PPIs) of membrane proteins using Membrane-SPINE: first, the confirmation of a proposed interaction partner by immunoblotting, and second, the identification of new interaction partners by mass spectrometry analysis. Moreover, even low affinity, transient PPIs are detectable by this technique. Finally, Membrane-SPINE is adaptable to almost any cell type, making it applicable as a powerful screening tool to identify PPIs of membrane proteins.

Membrane-SPINE: A Biochemical Tool to Identify Protein-protein Interactions of Membrane Proteins In Vivo

A biochemical approach is described to identify in vivo protein-protein interactions (PPI) of membrane proteins. The method combines protein cross-linking, affinity purification and mass spectrometry, and is adaptable to almost any cell type or organism. With this approach, even the identification of transient PPIs becomes possible.

Membran-OMURGA: Membran Proteinleri protein-protein etkileşimleri belirlemek için bir Biyokimyasal Aracı<em&gt; In Vivo</em

Membrane proteins are essential for cell viability and are therefore important therapeutic targets1-3. Since they function in complexes4, methods to ...

Biyomühendislik

Evaluation of Protein&#8211;Protein Interactions using an On-Membrane Digestion Technique

Numerous intracellular proteins physically interact in accordance with their intracellular and extracellular circumstances. Indeed, cellular functions largely depend on intracellular protein&#8211;protein interactions. Therefore, research regarding these interactions is indispensable to facilitating the understanding of physiologic processes. Co-precipitation of associated proteins, followed by mass spectrometry (MS) analysis, enables the identification of novel protein interactions. In this study, we have provided details of the novel technique of immunoprecipitation-liquid chromatography (LC)-MS/MS analysis combined with on-membrane digestion for the analysis of protein&#8211;protein interactions. This technique is suitable for crude immunoprecipitants and can improve the throughput of proteomic analyses. Tagged recombinant proteins were precipitated using specific antibodies; next, immunoprecipitants blotted onto polyvinylidene difluoride membrane pieces were subjected to reductive alkylation. Following trypsinization, the digested protein residues were analyzed using LC-MS/MS. Using this technique, we were able to identify several candidate associated proteins. Thus, this method is convenient and useful for the characterization of novel protein&#8211;protein interactions.

Here, we present a protocol for an on-membrane digestion technique for the preparation of samples for mass spectrometry. This technique facilitates the convenient analysis of protein&#8211;protein interactions.

Bir on-membran sindirim tekniği kullanılarak protein-protein etkileşimlerinin değerlendirilmesi

Numerous intracellular proteins physically interact in accordance with their intracellular and extracellular circumstances. Indeed, cellular functions ...

Use of Microscale Thermophoresis to Measure Protein-Lipid Interactions

The ability to determine the binding affinity of lipids to proteins is an essential part of understanding protein-lipid interactions in membrane trafficking, signal transduction and cytoskeletal remodeling. Classic tools for measuring such interactions include surface plasmon resonance (SPR) and isothermal titration calorimetry (ITC). While powerful tools, these approaches have setbacks. ITC requires large amounts of purified protein as well as lipids, which can be costly and difficult to produce. Furthermore, ITC as well as SPR are very time consuming, which could add significantly to the cost of performing these experiments. One way to bypass these restrictions is to use the relatively new technique of microscale thermophoresis (MST). MST is fast and cost effective using small amounts of sample to obtain a saturation curve for a given binding event. There currently are two types of MST systems available. One type of MST requires labeling with a fluorophore in the blue or red spectrum. The second system relies on the intrinsic fluorescence of aromatic amino acids in the UV range. Both systems detect the movement of molecules in response to localized induction of heat from an infrared laser. Each approach has its advantages and disadvantages. Label-free MST can use untagged native proteins; however, many analytes, including pharmaceuticals, fluoresce in the UV range, which can interfere with determination of accurate KD values. In comparison, labeled MST allows for a greater diversity of measurable pairwise interactions utilizing fluorescently labeled probes attached to ligands with measurable absorbances in the visible range as opposed to UV, limiting the potential for interfering signals from analytes.

Microscale thermophoresis obtains binding constants quickly at low material cost. Either labeled or label free microscale thermophoresis is commercially available; however, label free thermophoresis is not capable of the diversity of interaction measurements that can be performed using fluorescent labels. We provide a protocol for labeled thermophoresis measurements.

Protein-Lipid Etkileşimlerini Ölçmek için Mikro Ölçekli Termoforez Kullanımı

The ability to determine the binding affinity of lipids to proteins is an essential part of understanding protein-lipid interactions in membrane ...

PeptiQuick, a One-Step Incorporation of Membrane Proteins into Biotinylated Peptidiscs for Streamlined Protein Binding Assays

Membrane proteins, including transporters, channels, and receptors, constitute nearly one-fourth of the cellular proteome and over half of current drug targets. Yet, a major barrier to their characterization and exploitation in academic or industrial settings is that most biochemical, biophysical, and drug screening strategies require these proteins to be in a water-soluble state. Our laboratory recently developed the peptidisc, a membrane mimetic offering a &#8220;one-size-fits-all&#8221; approach to the problem of membrane protein solubility. We present here a streamlined protocol that combines protein purification and peptidisc reconstitution in a single chromatographic step. This workflow, termed PeptiQuick, allows for bypassing dialysis and incubation with polystyrene beads, thereby greatly reducing exposure to detergent, protein denaturation, and sample loss. When PeptiQuick is performed with biotinylated scaffolds, the preparation can be directly attached to streptavidin-coated surfaces. There is no need to biotinylate or modify the membrane protein target. PeptiQuick is showcased here with the membrane receptor FhuA and antimicrobial ligand colicin M, using biolayer interferometry to determine the precise kinetics of their interaction. It is concluded that PeptiQuick is a convenient way to prepare and analyze membrane protein-ligand interactions within one&#160;day in a detergent-free environment.

We present a method that combines membrane protein purification and reconstitution into peptidiscs in a single chromatographic step. Biotinylated scaffolds are used for direct surface attachment and measurement of protein-ligand interactions via biolayer interferometry.

PeptiQuick, Aerodinamik Protein Bağlayıcı Tahliller için Biyotinylated Peptidiskler içine Membran Proteinlerin Bir Adım Dahil

Membrane proteins, including transporters, channels, and receptors, constitute nearly one-fourth of the cellular proteome and over half of current drug ...

Native Cell Membrane Nanoparticles System for Membrane Protein-Protein Interaction Analysis

Protein-protein interactions in cell membrane systems play crucial roles in a wide range of biological processes- from cell-to-cell interactions to signal transduction; from sensing environmental signals to biological response; from metabolic regulation to developmental control. Accurate structural information of protein-protein interactions is crucial for understanding the molecular mechanisms of membrane protein complexes and for the design of highly specific molecules to modulate these proteins. Many in vivo and in vitro approaches have been developed for the detection and analysis of protein-protein interactions. Among them the structural biology approach is unique in that it can provide direct structural information of protein-protein interactions at the atomic level. However, current membrane protein structural biology is still largely limited to detergent-based methods. The major drawback of detergent-based methods is that they often dissociate or denature membrane protein complexes once their native lipid bilayer environment is removed by detergent molecules. We have been developing a&#160;native cell membrane nanoparticle system for membrane protein structural biology. Here, we demonstrate the use of this system in the analysis of protein-protein interactions on the cell membrane with a case study of the oligomeric state of AcrB.

Presented here is a protocol for the determination of oligomeric state of membrane proteins that utilizes a native cell membrane nanoparticle system in conjunction with electron microscopy.

Membran Protein-Protein Etkileşim Analizi için Yerli Hücreli Membran Nanopartiküller Sistemi

Protein-protein interactions in cell membrane systems play crucial roles in a wide range of biological processes- from cell-to-cell interactions to signal ...

In-vivo Detection of Protein-protein Interactions on Micro-patterned Surfaces

Unraveling the interaction network of molecules in-vivo is key to understanding the mechanisms that regulate cell function and metabolism. A multitude of methodological options for addressing molecular interactions in cells have been developed, but most of these methods suffer from being rather indirect and therefore hardly quantitative. On the contrary, a few high-end quantitative approaches were introduced, which however are difficult to extend to high throughput. To combine high throughput capabilities with the possibility to extract quantitative information, we recently developed a new concept for identifying protein-protein interactions (Schwarzenbacher et al., 2008). Here, we describe a detailed protocol for the design and the construction of this system which allows for analyzing interactions between a fluorophore-labeled protein ("prey") and a membrane protein ("bait") in-vivo. Cells are plated on micropatterned surfaces functionalized with antibodies against the bait exoplasmic domain. Bait-prey interactions are assayed via the redistribution of the fluorescent prey. The method is characterized by high sensitivity down to the level of single molecules, the capability to detect weak interactions, and high throughput capability, making it applicable as screening tool.

In-vivo Detection of Protein-protein Interactions on Micro-patterned Surfaces

This video shows experiments with subsequent analysis of protein-protein interactions by the use of micro-patterned surfaces. The approach offers the possibility to detect protein interactions in living cells and combines high throughput capabilities with the possibility to extract quantitative information.

Mikro desenli Yüzeyler, protein-protein etkileşimleri-vivo Algılama

Unraveling the interaction network of molecules in-vivo is key to understanding the mechanisms that regulate cell function and metabolism. A multitude of ...

Biyoloji

Protein Membrane Overlay Assay: A Protocol to Test Interaction Between Soluble and Insoluble Proteins in vitro

Validating interactions between different proteins is vital for investigation of their biological functions on the molecular level. There are several methods, both in vitro and in vivo, to evaluate protein binding, and at least two methods that complement the shortcomings of each other should be conducted to obtain reliable insights. 
For an in vivo assay, the bimolecular fluorescence complementation (BiFC) assay represents the most popular and least invasive approach that enables to detect protein-protein interaction within living cells, as well as identify the intracellular localization of the interacting proteins 1,2. In this assay, non-fluorescent N- and C-terminal halves of GFP or its variants are fused to tested proteins, and when the two fusion proteins are brought together due to the tested proteins&#x2019; interactions, the fluorescent signal is reconstituted3-6. Because its signal is readily detectable by epifluorescence or confocal microscopy, BiFC has emerged as a powerful tool of choice among cell biologists for studying about protein-protein interactions in living cells 3. This assay, however, can sometimes produce false positive results. For example, the fluorescent signal can be reconstituted by two GFP fragments arranged as far as 7 nm from each other due to close packing in a small subcellular compartment, rather that due to specific interactions7.
Due to these limitations, the results obtained from live cell imaging technologies should be confirmed by an independent approach based on a different principle for detecting protein interactions. Co-immunoprecipitation (Co-IP) or glutathione transferase (GST) pull-down assays represent such alternative methods that are commonly used to analyze protein-protein interactions in vitro. However, iIn these assays, however, the tested proteins must be readily soluble in the buffer that supportsused for the binding reaction. Therefore, specific interactions involving an insoluble protein cannot be assessed by these techniques.
 Here, we illustrate the protocol for the protein membrane overlay binding assay, which circumvents this difficulty. In this technique, interaction between soluble and insoluble proteins can be reliably tested because one of the proteins is immobilized on a membrane matrix. This method, in combination with in vivo experiments, such as BiFC, provides a reliable approach to investigate and characterize interactions faithfully between soluble and insoluble proteins. In this article, binding between Tobacco mosaic virus (TMV) movement protein (MP), which exerts multiple functions during viral cell-to-cell transport8-14, and a recently identified plant cellular interactor, tobacco ankyrin repeat-containing protein (ANK) 15, is demonstrated using this technique.

Protein Membrane Overlay Assay: A Protocol to Test Interaction Between Soluble and Insoluble Proteins in vitro

Testing protein-protein interaction is indispensable for dissection of protein functionality. Here, we introduce an in vitro protein-protein binding assay to probe a membrane-immobilized protein with a soluble protein. This assay provides a reliable method to test interaction between an insoluble protein and a protein in solution.

Protein Membran Kaplama Testi: Çözünür ve çözünmez Proteinler Arasında Etkileşim Test Protokolü In vitro</em

Validating interactions between different proteins is vital for investigation of their biological functions on the molecular level.  There are several ...

Fluorescence-Detection Size-Exclusion Chromatography: A Technique to Identify the Integrity of Fluorescent Membrane Proteins upon Detergent Solubilization

Source: Bird, L. E., et al. <a href="https://www.jove.com/v/52357">Green Fluorescent Protein-based Expression Screening of Membrane Proteins in Escherichia coli</a>. J. Vis. Exp. (2015)
In this video, we demonstrate a fluorescence-detection size-exclusion chromatography technique to screen for green fluorescent protein (GFP)-fused membrane protein stability in Escherichia coli following detergent solubilization. Proteins exhibiting a symmetrical peak in the size-exclusion profile with little or no free GFP indicate purified proteins with minimum degradation and aggregation, which can subsequently be selected for structure-function analysis.

Floresan Algılama Boyut Dışlama Kromatografisi: Deterjan Çözündürmesi Üzerine Floresan Membran Proteinlerinin Bütünlüğünü Belirleme Tekniği

Source: Bird, L. E., et al. Green Fluorescent Protein-based Expression Screening of Membrane Proteins in Escherichia coli. J. Vis. Exp. (2015)
In this ...

Membran proteinlerinin Hofstede deterjan duyarlı tespiti

Özet

Daha Fazla Video Keşfet

Bu videodaki bölümler