Diese Arbeit wurde von Forschungsstipendien, die DK52057 und DK107498 von der NIH, K.V.K. X.P wurde unterstützt durch die institutionelle Ausbildung Grant 2T32DK007201 vom NIH unterstützt.

1. Handling des Peptids
<ol><li>Gestaltung und Bestellung des Peptids<ol>
<li>Wählen Sie die gewünschte Reihenfolge des Peptids, und fügen Sie ein Tag, wie Myc Epitop (EQKLISEED) an die beiden N - oder C-Terminus.</li>
		<li>Überprüfen Sie die vorhergesagte Löslichkeit des Peptids in Wasser mit Peptid Löslichkeit Rechner http://pepcalc.com/peptide-solubility-calculator.php. Wenn die Löslichkeit gering ist, versuchen Sie, eine andere wasserlösliche markierst, um die Ladung Balance ändern. Hinweis: Wir haben das Peptid entspricht der ersten luminalen Schleife (Fll) von GLUT4 mit dem Stichwort Myc Epitop (Fette Schrift) am N-Terminus (Myc-Fll-GLUT4): EQKLISEEDLNAPQKVIEQSYNATWLGRQGPGGPSSIPPGTLTTLWA, das "gute" vorhergesagten Löslichkeit in Wasser hat .</li>
		<li>Bestellen Sie das benutzerdefinierte Peptid mit mindestens 75 % Reinheit, das reicht für den Assay und Löslichkeit Test den Anbieter erfragen. Trennen Sie die Reihenfolge, in mindestens zwei Aliquote bei unvorhergesehenen Problemen mit Auflösung das Peptid. Hinweis: Myc-Fll-GLUT4 wurde in zwei Aliquote bestellt. Die gemeldeten Löslichkeit in Reinstwasser ist ≤10 mg/mL.</li>
	</ol>
</li>
	<li>Das Peptid auflösen Hinweis: Reinstwasser ist das beste Lösungsmittel. Erscheint das Peptid nicht wasserlöslich sein, beziehen sich auf http://www.genscript.com/peptide_solubility_and_stablity.html für Anweisungen.<ol>
<li>Bereiten Sie 100 x Arbeitslösung des Peptids in Reinstwasser oder Puffer Wahl, mit der Konzentration von 100 μg/mL.</li>
		<li>Trennen Sie die Lösung in 50-100 µL Aliquots, und speichern sie bei-20 ° C.</li>
	</ol>
</li>
</ol>2. Umgang mit Zellen
<ol><li>Zellkultur<ol>
<li>Verwenden Sie Wildtyp (WT) Zellen als eine Negativkontrolle und Zellen mit dem Ausdruck des Zielproteins getaggt mit sechs Histidin (HisP). Hinweis: Wir haben 3 t 3 L1 Pre Adipozyten mit Sortilin-Myc/His5stabil transfiziert.</li>
		<li>Wachsen die Zellen in Dulbeccos geändert Eagle Medium (DMEM) stark zuckerhaltige, ergänzt mit 10 % Kälberserum bovine, Glutamin (2 mM) und Penicillin/Streptomycin (5 μg/mL) bei 37 ° C in 10 % CO2.</li>
		<li>Sitzen Sie vier 10 cm-Gerichte der Zellen, transfizieren Sie zwei davon mit HisP und transfizieren Sie, die anderen beiden mit Kontrolle Plasmid (WT). 48 h nach Transfektion Zellen sollten 80-90 % Konfluenz zu erreichen.</li>
	</ol>
</li>
	<li>Vorbereitung der Zelle Lysates<ol>
<li>Lyse-Puffer (10 mM Hepes, 30 mM NaCl, 5 % Glycerin, 10 mM Imidazol, 0,5 % Triton x-100 und Protease Inhibitor cocktail ohne EDTA für die Isolierung des His-Tags Proteine, pH 7,4) vorbereiten und halten Sie es bei 4 ° C:</li>
		<li>Waschen Sie Zellen dreimal mit 10 mL 1 x Phosphat-gepufferte Kochsalzlösung (PBS) bei 4 ° C.</li>
		<li>Die Gerichte auf Eis gelegt und jedes Gericht 500 µL Puffer Lyse hinzufügen. Die Zelle Lysates mit einem Schaber Zelle zu ernten.</li>
		<li>Setzen Sie die Zelle lysate aus jedem Gericht ein anderes 1,5 mL-Tube. Beschriften Sie die Rohre als WT-pH6, WT-pH8, HisP-pH6, HisP-pH8.</li>
		<li>Durchlaufen der Zelle Lysates eine Spritze mit einer Nadel 26G fünfmal rauf und runter, komplette Lyse.</li>
		<li>Zentrifugieren Sie die Zelle Lysates 16.000 x g für 10 min bei 4 ° C.</li>
		<li>Übertragen Sie die Überstände auf neue identisch gekennzeichneten Rohre.</li>
		<li>Mit dem BCA Protein Assay Kit oder andere Kit Proteinkonzentration zu analysieren.</li>
		<li>Mit Lyse Puffer, Proteinkonzentration von allen vier Lysates auszugleichen.</li>
		<li>Trennen Sie eine kleine (ca. 20 µL) Aliquot der jeweils lysate zu und halten Sie sie bei-20 ° C für mögliche Experimente und/oder Fehlersuche.</li>
	</ol>
</li>
</ol>3. verbindliche sein-tagged Proteine, die HisPur Kobalt-Perlen
<ol><li>Verwenden Sie handelsübliche Waschpuffer oder bereiten Sie vor (50 mM Na2HPO4/NaH2PO4, 300 mM NaCl, 20 mM Imidazol, pH 8) und halten Sie es bei 4 ° C.</li>
	<li>Bereiten Sie waschen-Puffer mit pH 6 kichern waschen Puffer pH 8 mit HCl. halten Sie es bei 4 ° C.</li>
	<li>Vorsichtig schwenken die Flasche die Kobalt-Perlen, homogene Suspension zu machen.</li>
	<li>40 µL der Kobalt-Perlen-Suspension in vier 1,5 mL Röhrchen markiert wie oben beschrieben (Schritt 2.2.4) zu verzichten.</li>
	<li>Jedes Rohr 1 mL Lyse Puffer hinzu und Zentrifugieren Sie der Rohre bei 1000 X g für 5 S. Aspirat überstand, und ständiger Perlen fügen Sie 40 μL der Lyse Puffer hinzu.</li>
	<li>Entsprechenden Röhren der Zelle Lysates hinzufügen.</li>
	<li>Inkubieren Sie die Rohre für 90 min bei 4 ° C auf ein Rohr Rotator bei 20 u/min.</li>
	<li>Zentrifugieren Sie die Rohre bei 1000 x g für 5 s und sammeln der Überstand. Halten Sie den Überstand bei 4 ° C.</li>
	<li>Entsprechende Rohre 500 µL pH 8 oder pH 6 Waschpuffer hinzufügen und erneut aussetzen der Perlen sanft.</li>
	<li>Zentrifugieren Sie die Rohre bei 1000 X g für 5 s und entsorgen die Überstände.</li>
	<li>Wiederholen Sie die Schritte, 3.9 und 3.10 viermal.</li>
</ol>(4) die Bindung des Peptids zu sein-tagged Proteins an den Perlen immobilisiert
<ol><li>Mit 100 X Arbeitslösung des Peptids (Schritt 1.2.1), 1 x Arbeitslösungen in pH 6 oder pH 8 Waschpuffer (zwei 100 µL Aliquots für jede, 1 µg/mL) vorzubereiten.</li>
	<li>Die gewaschenen Perlen mit den entsprechenden pH-Wert 100 μl 1 X Peptid-Lösung hinzufügen.</li>
	<li>Inkubieren Sie die Perlen für 30 min bei 4 ° C auf ein Rohr Rotator bei 20 u/min.</li>
	<li>Zentrifugieren Sie die Rohre bei 1.000 x g für 5 s, den Überstand zu sammeln und bewahren Sie es bei-20 ° C.</li>
	<li>Wiederholen Sie die Schritte, 3.9 und 3.10 viermal. Hinweis: Um möglichen Hintergrund zu verringern, können die folgenden Schritte Schritte 4.4 und 4.5 ersetzen.</li>
	<li>Nehmen Sie vier Mikro Spalten mit 30 μm Poren, beschriften Sie sie wie in Schritt 2.2.4 und legen Sie die Spalten in Röhrchen.</li>
	<li>Nach Abschluss von Schritt 4.3, übertragen Sie die Inkubation-Mischung in die Spalten, lassen Sie die Lösung durch die Schwerkraft durchlaufen. Halten Sie die Durchströmung bei-20 ° C.</li>
	<li>Übergeben Sie 500 µL Waschpuffer mit pH 6 und pH 8 durch entsprechenden Spalten, durch die Schwerkraft. Die Durchströmung zu verwerfen.</li>
	<li>Wiederholen Sie Schritt 4.8 viermal.</li>
	<li>Nach der letzten Wäsche Zentrifuge die Spalten bei 1.000 x g für 15 s.</li>
</ol>5. Elution von Kobalt-Perlen
<ol><li>Verwendung kommerzieller Tricine Probenpuffer (200 mM Tris-HCl, 40 % Glycerin, 2 % SDS, 0,04 % Coomassie Blau, pH 6,8) und die letztendliche Konzentration von 2 % β-Mercaptoethanol hinzufügen.</li>
	<li>Die gewaschenen Perlen und Wirbel der Probe 40 µL Probenpuffer Tricine (mit β-Mercaptoethanol) hinzufügen.</li>
	<li>Die Proben für 10 min bei 100 ° C erwärmen Wirbel wieder, die Proben und Zentrifugieren der Rohre bei 1.000 x g für 5 s. Hinweis: Um mögliche unspezifische Bindung in der Elution zu verringern, können die folgenden Schritte Schritte 5.1-5.3 ersetzen.</li>
	<li>Die gewaschenen 40 μL der Elution Imidazol-Puffer (50 mM Na2HPO4/NaH2PO4, 300 mM NaCl, 0,25 M Imidazol) hinzufügen Perlen, Wirbel und die Rohre bei Raumtemperatur für 20 min inkubieren.</li>
	<li>Zentrifugieren Sie die Rohre bei 3.000 x g für 30 s, den überstand (eluierten Proben) zu sammeln und auf neue beschriftete Rohre übertragen.</li>
	<li>Jedes Rohr 40 μl Probenpuffer Tricine hinzu, die Proben für 10 min bei 100 ° C, Wirbel und Zentrifuge Erwärmen der Röhren bei 1.000 x g für 5 s. Hinweis: Wenn Mikro Spalten die gewaschenen Perlen der Elution Buffer hinzufügen verwendet werden, 20 min inkubieren Sie und sammeln Sie die Elution durch Zentrifugation bei 8.000 x g 2 min. lang. Hinweis: Proben können bei-20 ° C gehalten werden, bis die Elektrophorese durchgeführt wird.</li>
</ol>6. Elektrophorese und Western blotting
Hinweis: Die Proben sind bereit für die Trennung von SDS-PAGE und spätere westliche Beflecken. Folgen Sie Protokoll der Gelelektrophorese (https://www.jove.com/science-education/5065/the-western-blot) mit den folgenden Änderungen.
<ol><li>Verwenden Sie handelsübliche 10-20 % Tricine gradient Gele.</li>
	<li>Laden Sie auf das Gel 20 µL der eluierten Proben und 20 µL Lysates (Schritt 2.2.10). Für die Fehlersuche, es wird empfohlen, 20 µL des ungebundenen Materials (Schritt 3,8) laden und 10 ng des Peptids; Diese Proben vor dem Laden gleich viel Tricine Probenpuffer hinzugefügt.</li>
	<li>Elektrophorese in kommerziellen Tris/Tricine/SDS laufen Puffer (100 mM Tris, 100 mM Tricine, und 0,1 % SDS, pH 8,3) durchführen.</li>
	<li>Übertragen Sie das Material, aus dem Gel auf eine 0,45 µm Nitrozellulose-Membran mit Transfer-Puffer (25 mM Tris-Base, 192 mM Glycin, pH 8,4) ergänzt mit 20 % Methanol.</li>
	<li>Blockieren Sie die Membran mit 3 % Bovine Serum Albumin (BSA) für 1 h bei Raumtemperatur. Pre-gefärbten Molekulargewicht Marker als Hilfslinien verwenden, schneiden Sie die Membran horizontal, Tupfen Sie das Oberteil mit einem Antikörper gegen HisP und tupfen Sie den Unterteil mit einem Antikörper gegen das Myc-Epitop, das Myc-markierte Peptid zu identifizieren. Hinweis: In unserem speziellen Fall ist Schneiden der Membran nicht erforderlich da HisP und Myc-Fll-GLUT4 mit einem Anti-Myc-Antikörper nachgewiesen werden können.</li>
</ol>7. Analyse der Ergebnisse
<ol><li>Quantifizieren Sie die Intensität aller Western-Blot-Signale mit einem Bild Station oder ImageJ-Programm.</li>
	<li>Das Signal vom Myc-markierte Peptid gegen das Signal vom HisP bei beiden pH-Werten zu normalisieren.</li>
</ol>

<ol>
	<li>Bogan, J. S. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Regulation+of+glucose+transporter+translocation+in+health+and+diabetes.">Regulation of glucose transporter translocation in health and diabetes.</a> Annu Rev Biochem. 81, 507-532 (2012).</li><li>Kandror, K. V., Pilch, P. F. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+sugar+is+sIRVed:+sorting+Glut4+and+its+fellow+travelers.">The sugar is sIRVed: sorting Glut4 and its fellow travelers.</a> Traffic. 12 (6), 665-671 (2011).</li><li>Pan, X., Zaarur, N., Singh, M., Morin, P., Kandror, K. V. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Sortilin+and+retromer+mediate+retrograde+transport+of+Glut4+in+3T3-L1+adipocytes.">Sortilin and retromer mediate retrograde transport of Glut4 in 3T3-L1 adipocytes.</a> Mol Biol Cell. 28 (12), 1667-1675 (2017).</li><li>Kim, J., Kandror, K. V. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+first+luminal+loop+confers+insulin+responsiveness+to+the+glucose+transporter+4.">The first luminal loop confers insulin responsiveness to the glucose transporter 4.</a> Mol Biol Cell. 23 (5), 910-917 (2012).</li><li>Shi, J., Kandror, K. V. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Sortilin+is+essential+and+sufficient+for+the+formation+of+Glut4-storage+vesicles+in+3T3-L1+adipocytes.">Sortilin is essential and sufficient for the formation of Glut4-storage vesicles in 3T3-L1 adipocytes.</a> Dev Cell. 9 (1), 99-108 (2005).</li><li>Coutinho, M. F., Prata, M. J., Alves, S. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=A+shortcut+to+the+lysosome:+the+mannose-6-phosphate-independent+pathway.">A shortcut to the lysosome: the mannose-6-phosphate-independent pathway.</a> Mol Genet Metab. 107 (3), 257-266 (2012).</li><li>Willnow, T. E., Petersen, C. M., Nykjaer, A. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=VPS10P-domain+receptors+-+regulators+of+neuronal+viability+and+function.">VPS10P-domain receptors - regulators of neuronal viability and function.</a> Nat Rev Neurosci. 9 (12), 899-909 (2008).</li><li>Mazella, J., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+100-kDa+neurotensin+receptor+is+gp95/sortilin,+a+non-G-protein-coupled+receptor.">The 100-kDa neurotensin receptor is gp95/sortilin, a non-G-protein-coupled receptor.</a> J Biol Chem. 273 (41), 26273-26276 (1998).</li><li>Ni, X., Morales, C. R. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+Lysosomal+Trafficking+of+Acid+Sphingomyelinase+is+Mediated+by+Sortilin+and+Mannose+6-phosphate+Receptor.">The Lysosomal Trafficking of Acid Sphingomyelinase is Mediated by Sortilin and Mannose 6-phosphate Receptor.</a> Traffic. 7 (7), 889-902 (2006).</li><li>Westergaard, U. B., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Functional+organization+of+the+sortilin+Vps10p+domain.">Functional organization of the sortilin Vps10p domain.</a> J Biol Chem. 279 (48), 50221-50229 (2004).</li><li>Nykjaer, A., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Sortilin+is+essential+for+proNGF-induced+neuronal+cell+death.">Sortilin is essential for proNGF-induced neuronal cell death.</a> Nature. 427 (6977), 843-848 (2004).</li></ol>

Die Autoren haben nichts preisgeben.

Sortilin ist ein evolutionär konservierte Multi-Liganden-Protein-Rezeptor, der bei beiden Signalisierung an der Plasmamembran und in intrazellulären Sortierung Veranstaltungen6,7beteiligt ist. Die Suche nach dem authentischen Sortilin Liganden (einige davon sind luminalen oder integraler Membranproteine) ist jedoch komplizierter, wie das Zusammenspiel von Sortilin mit einigen seiner Bindungspartner zu empfindlich auf Waschmittel zu sein scheint. Daher eine einf...

GLUT4 ist ein Glukose-Transporter-Protein, das vorwiegend in Fett und skelettartigen Muskelzellen exprimiert ist wo es die Wirkung des Insulins auf postprandialen Blut Glukose Abstand1vermittelt. Ein sehr stabiles Protein ist, GLUT4 auf ein post-translationalen Ebene geregelt. In Abwesenheit von Insulin GLUT4 wird weitgehend von der Plasmamembran (daher niedrige basale Durchlässigkeit für Glukose) ausgeschlossen und wird vor allem innerhalb der Zelle in kleinen Insulin eine geschlechtergerechte Vesikeln (IRVs) lokalisiert und Trans-Golgi-Netzwerk (TGN), die voraussichtlich vertreten sind IRV-Spender-Fach. Bei der Insulinverabreichung die IRVs verschmelzen mit der Plasmamembran und liefern GLUT4 an die Seite seines Funktionierens. Dies erhöht die Durchlässigkeit der Plasmamembran für Glucose, so dass Glukoseaufnahme aus Blut in Adipozyten und Skelett Myozyten 10 bis 40-fold steigt. Nach dem Rückzug Insulin ist GLUT4 in frühen/Sortierung Endosomen verinnerlicht und dann abgerufen, TGN wo die IRVs neu formiert werden. Beide sortieren Schritte in den GLUT4 Weg, d.h. Entnahme von peripheren frühen Endosomen bis Perinukleäre TGN und die Bildung der IRVs auf der TGN-Spender, die Membranen von Vps10p Familienmitglied, Sortilin, aktiviert sind, die einen Typ darstellt ich transmembranen Protein und Sortier-Rezeptor. Nach einem Modell Sortilin arbeitet als ein transmembranen Gerüst-Protein: es bindet GLUT4 in das Lumen der Endosomen und TGN und Rekruten Retromer oder Clathrin-Adapter auf der cytoplasmatischen Seite der Spender Membran über dem C-Terminus2, 3. Dies erleichtert die Verteilung von GLUT4 in vesikuläre Träger, die GLUT4 zwischen intrazellulären Kompartimenten translozieren.
Das Zusammenspiel der cytoplasmatischen Schwanz des Sortilin mit Retromer und verschiedene Adapter-Proteine ist gut dokumentiert. Jedoch ist die Bindung des Sortilin GLUT4 (und einige seiner anderen Protein-Liganden) eine Herausforderung gewesen um zu beweisen. Insbesondere sind Versuche, co-Immunoprecipitate Sortilin und GLUT4 nicht wahrscheinlich aufgrund der Waschmittel-Sensitive Art der Interaktion zwischen diesen beiden Proteinen erfolgreich gewesen. Darüber hinaus als eine typische Transporter-Protein hat GLUT4 12 transmembranen Domänen und 6 luminalen Loops beliebige, die Kombination davon möglicherweise eine Sortilin-Bindungsstelle darstellen kann. Zur gleichen Zeit die ein großer Körper der indirekten Beweis, wie die erheblichen Co Lokalisierung in der Zelle, Vernetzung mit Membran durchlässig DSP und der Interaktion in Hefe-zwei-Hybrid-System empfehlen, dass Sortilin GLUT4 gebunden werden kann. Darüber hinaus haben mit den letzteren Ansatz in Kombination mit der Alanin Scannen Mutagenese, wir zuvor festgestellt, dass die Vps10p-Domäne des Sortilin in erster Linie an die erste luminalen Schleife von GLUT4 bindet. Allerdings hat der Beweis für solch eine Interaktion in Säugetierzellen gefehlt. Hier haben wir isoliert sein-tagged Sortilin von 3 t 3-L1 transfizierten Zellen mit Kobalt Harz und gezeigt, dass es chemisch synthetisierten Peptid entspricht der ersten luminalen Schleife des GLUT4 bei pH 6 und pH 8 interagieren kann, die im sauren Milieu ähneln die Endosomal Lumen und neutralen Umgebung in das Lumen der TGN-Membranen. Keine Peptid-Bindung wurde in Experimente nachgewiesen dem Extrakt aus nicht transfizierten Zellen vorbereitet auf den gleichen Perlen geladen wurde.

<table border="0" cellpadding="0" cellspacing="0" width="608">
	<tbody>
		<tr height="42">
			<td height="42" style="height:42px;width:216px;">Protease inhibitor cocktail</td>
			<td style="width:107px;">Sigma</td>
			<td style="width:119px;">P8849</td>
			<td style="width:167px;">for use in purification of histidine tag protein</td>
		</tr>
		<tr height="21">
			<td height="21" style="height:21px;width:216px;">Phosphate-Buffered Saline&#160;</td>
			<td style="width:107px;">Corning</td>
			<td style="width:119px;">21-040-CV</td>
			<td style="width:167px;">PBS</td>
		</tr>
		<tr height="21">
			<td height="21" style="height:21px;width:216px;">1mL Insulin Syringe U-100</td>
			<td style="width:107px;">BD</td>
			<td style="width:119px;">329652</td>
			<td style="width:167px;">26G x 1/2</td>
		</tr>
		<tr height="21">
			<td height="21" style="height:21px;width:216px;">BCA Protein Assay Kit</td>
			<td style="width:107px;">Pierce</td>
			<td style="width:119px;">23228</td>
			<td style="width:167px;"></td>
		</tr>
		<tr height="42">
			<td height="42" style="height:42px;width:216px;">Wash buffer</td>
			<td style="width:107px;">Boston BioProducts</td>
			<td style="width:119px;">BP-234</td>
			<td style="width:167px;">For His-tag protein purification</td>
		</tr>
		<tr height="42">
			<td height="42" style="height:42px;width:216px;">HisPur Cobalt Resin</td>
			<td style="width:107px;">Thermo Scientific</td>
			<td style="width:119px;">89964</td>
			<td style="width:167px;"></td>
		</tr>
		<tr height="63">
			<td height="63" style="height:63px;width:216px;">Tricine sample Buffer</td>
			<td style="width:107px;">Bio-Rad</td>
			<td style="width:119px;">161-0739</td>
			<td style="width:167px;">with SDS, bMercaptaethanol should be added</td>
		</tr>
		<tr height="63">
			<td height="63" style="height:63px;width:216px;">Elution&#160; Buffer</td>
			<td style="width:107px;">Boston BioProducts</td>
			<td style="width:119px;">BP-236</td>
			<td style="width:167px;">For His-tag protein purificationwith 250mM Imidazole</td>
		</tr>
		<tr height="63">
			<td height="63" style="height:63px;width:216px;">Mini-Protean Tris-Tricine precast gels 10-20%&#160;</td>
			<td style="width:107px;">Bio-Rad</td>
			<td style="width:119px;">456-3115</td>
			<td style="width:167px;">For seperation of peptide and small protein</td>
		</tr>
		<tr height="21">
			<td height="21" style="height:21px;width:216px;">Tris/Tricine/SDS running buffer&#160;</td>
			<td style="width:107px;">Bio-Rad</td>
			<td style="width:119px;">161-0744</td>
			<td style="width:167px;"></td>
		</tr>
		<tr height="42">
			<td height="42" style="height:42px;width:216px;">Transfer Buffer</td>
			<td style="width:107px;">Boston BioProducts</td>
			<td style="width:119px;">BP-190</td>
			<td style="width:167px;">Add 20% methanol</td>
		</tr>
		<tr height="42">
			<td height="42" style="height:42px;width:216px;">Nitrocellulose membrane&#160; 0.45 mm</td>
			<td style="width:107px;">Bio-Rad</td>
			<td style="width:119px;">1620115</td>
			<td style="width:167px;"></td>
		</tr>
		<tr height="21">
			<td height="21" style="height:21px;width:216px;">Bovine Serum Albumin</td>
			<td style="width:107px;">Sigma</td>
			<td style="width:119px;">A9647</td>
			<td style="width:167px;">BSA</td>
		</tr>
		<tr height="21">
			<td height="21" style="height:21px;width:216px;">Anti Myc antibody</td>
			<td style="width:107px;">Cell Signaling</td>
			<td style="width:119px;">2272</td>
			<td style="width:167px;">Rabbit</td>
		</tr>
		<tr height="21">
			<td height="21" style="height:21px;width:216px;">Peptide</td>
			<td style="width:107px;">Genscipt</td>
			<td style="width:119px;"></td>
			<td>customize ordering</td>
		</tr>
		<tr height="42">
			<td height="42" style="height:42px;width:216px;">Precision Plus Protein Dual color Standarts</td>
			<td style="width:107px;">BioRad</td>
			<td style="width:119px;">161-0374</td>
			<td></td>
		</tr>
	</tbody>
</table>

detection of detergent-sensitive interactions between membrane proteins

Unsere Fähigkeit, Protein-Protein-Wechselwirkungen zu erforschen ist der Schlüssel zum Verständnis der rechtlicher Verbindungen in der Zelle. Nachweis von Protein-Protein-Interaktionen in vielen Fällen ist jedoch mit erheblichen experimentelle Herausforderungen verbunden. Insbesondere interagieren Sortierung Rezeptoren mit ihrer Ladung Eiweiß in das Lumen der Membran Fächer oft in ein Waschmittel-Sensitive-Mode, so dass co-Immunopräzipitation dieser Proteine unbrauchbar. Bindung von der Sortierung Rezeptor Sortilin, Glukose-Transporter GLUT4 als Beispiel für schwache luminalen Wechselwirkungen zwischen Membranproteine dienen kann. Hier beschreiben wir einen schnelle, einfachen und kostengünstigen Assay um die Interaktion zwischen Sortilin und GLUT4 zu überprüfen. Dafür haben wir entworfen und chemisch synthetisiert die Myc-markierte Peptid entspricht der potenziellen Sortilin-Bindung-Epitop in der luminalen Teil des GLUT4. Sortilin mit dem Stichwort sechs Histidin war in Säugerzellen ausgedrückt und isoliert von Zelle Lysates mit Kobalt Perlen. Sortilin an den Perlen immobilisiert wurde die Peptid-Lösung bei verschiedenen pH-Werten inkubiert und der eluierten Material wurde durch Western Blot analysiert. Dieser Test kann leicht an andere Waschmittel-Sensitive Protein-Protein-Interaktionen zu untersuchen sein.

Lysates wurden von 3 t 3 L1 Zellen stabil transfizierten mit Sortilin-Myc/His5 und von WT 3 t 3 L1 Zellen, verwendet als Negativkontrolle vorbereitet. Beide Lysates waren mit Kobalt Perlen bei pH 6 und pH 8 inkubiert und gründlich gewaschen. Kügelchen mit immobilisierten Proteine wurden dann bei der Lösung von Myc-Fll-Glut4 inkubiert. Nach sorgfältiger Wäschen waren Proteine gebunden, die Perlen mit 0,25 M Imidazol eluiert. Proben wurden ausgesetzt, zusammen m...

Watch this Scientific Journal Video about Detection of Detergent-sensitive Interactions Between Membrane Proteins at JoVE.com

Detection of Detergent-sensitive Interactions Between Membrane Proteins

Wir beschreiben ein Protokoll für die Erkennung von Waschmittel-Sensitive Interaktionen zwischen Membranproteine mit Bindung des Sortier-Rezeptors, Sortilin, um die erste luminalen Schleife von der Glukose-Transporter-Protein, GLUT4, als Beispiel.

Erkennung von Waschmittel-Sensitive Interaktionen zwischen Membranproteine

Our ability to explore protein-protein interactions is the key to understanding regulatory connections in the cell. However, detection of protein-protein ...

detection-detergent-sensitive-interactions-between-membrane

Research

JoVE Journal

Biochemistry

5.9K Aufrufe.  Boston University School of Medicine. Wir beschreiben ein Protokoll für die Erkennung von Waschmittel-Sensitive Interaktionen zwischen Membranproteine mit Bindung des Sortier-Rezeptors, Sortilin, um die erste luminalen Schleife von der Glukose-Transporter-Protein, GLUT4, als Beispiel.

Serie: Detection of Detergent-sensitive Interactions Between Membrane Proteins

Using Scaffold Liposomes to Reconstitute Lipid-proximal Protein-protein Interactions In Vitro

Studies of integral membrane proteins in vitro are frequently complicated by the presence of a hydrophobic transmembrane domain. Further complicating these studies, reincorporation of detergent-solubilized membrane proteins into liposomes is a stochastic process where protein topology is impossible to enforce. This paper offers an alternative method to these challenging techniques that utilizes a liposome-based scaffold. Protein solubility is enhanced by deletion of the transmembrane domain, and these amino acids are replaced with a tethering moiety, such as a His-tag. This tether interacts with an anchoring group (Ni2+ coordinated by nitrilotriacetic acid (NTA(Ni2+)) for His-tagged proteins), which enforces a uniform protein topology at the surface of the liposome. An example is presented wherein the interaction between Dynamin-related protein 1 (Drp1) with an integral membrane protein, Mitochondrial Fission Factor (Mff), was investigated using this scaffold liposome method. In this work, we have demonstrated the ability of Mff to efficiently recruit soluble Drp1 to the surface of liposomes, which stimulated its GTPase activity. Moreover, Drp1 was able to tubulate the Mff-decorated lipid template in the presence of specific lipids. This example demonstrates the effectiveness of scaffold liposomes using structural and functional assays and highlights the role of Mff in regulating Drp1 activity.

Using Scaffold Liposomes to Reconstitute Lipid-proximal Protein-protein Interactions In Vitro

This paper describes a method for assessing the interactions and assemblies of integral membrane proteins in vitro with various partner factors in a lipid-proximal environment.

Scaffold Liposomen zu rekonstituieren Lipid-proximalen Protein-Protein-Wechselwirkungen<em&gt; In Vitro</em

Studies of integral membrane proteins in vitro are frequently complicated by the presence of a hydrophobic transmembrane domain. Further complicating ...

Forschung

Biochemie

Method to Visualize and Analyze Membrane Interacting Proteins by Transmission Electron Microscopy

Monotopic proteins exert their function when attached to a membrane surface, and such interactions depend on the specific lipid composition and on the availability of enough area to perform the function. Nanodiscs are used to provide a membrane surface of controlled size and lipid content. In the absence of bound extrinsic proteins, sodium phosphotungstate-stained nanodiscs appear as stacks of coins when viewed from the side by transmission electron microscopy (TEM). This protocol is therefore designed to intentionally promote stacking; consequently, the prevention of stacking can be interpreted as the binding of the membrane-binding protein to the nanodisc. In a further step, the TEM images of the protein-nanodisc complexes can be processed with standard single-particle methods to yield low-resolution structures as a basis for higher resolution cryoEM work. Furthermore, the nanodiscs provide samples suitable for either TEM or non-denaturing gel electrophoresis. To illustrate the method, Ca2+-induced binding of 5-lipoxygenase on nanodiscs is presented.

Many proteins perform their function when attached to membrane surfaces. The binding of extrinsic proteins on nanodisc membranes can be indirectly imaged by transmission electron microscopy. We show that the characteristic stacking (rouleau) of nanodiscs induced by the negative stain sodium phosphotungstate is prevented by the binding of extrinsic protein.

Verfahren zum Visualisieren und Analysieren Membran interagierender Proteine ​​durch Transmissionselektronenmikroskopie

Monotopic proteins exert their function when attached to a membrane surface, and such interactions depend on the specific lipid composition and on the ...

Extracellular Protein Microarray Technology for High Throughput Detection of Low Affinity Receptor-Ligand Interactions

Secreted factors, membrane-tethered receptors, and their interacting partners are main regulators of cellular communication and initiation of signaling cascades during homeostasis and disease, and as such represent prime therapeutic targets. Despite their relevance, these interaction networks remain significantly underrepresented in current databases; therefore, most extracellular proteins have no documented binding partner. This discrepancy is primarily due to the challenges associated with the study of the extracellular proteins, including expression of functional proteins, and the weak, low affinity, protein interactions often established between cell surface receptors. The purpose of this method is to describe the printing of a library of extracellular proteins in a microarray format for screening of protein-protein interactions. To enable detection of weak interactions, a method based on multimerization of the query protein under study is described. Coupled to this microbead-based multimerization approach for increased multivalency, the protein microarray allows robust detection of transient protein-protein interactions in high throughput. This method offers a rapid and low sample consuming-approach for identification of new interactions applicable to any extracellular protein. Protein microarray printing and screening protocol are described. This technology will be useful for investigators seeking a robust method for discovery of protein interactions in the extracellular space.

Here, we present a protocol to screen extracellular protein microarrays for identification of novel receptor-ligand interactions in high throughput. We also describe a method to enhance detection of transient protein-protein interactions by using protein-microbead complexes.

Extrazelluläre Protein-Microarray-Technologie für hohen Durchsatz-Erkennung von geringe Affinität-Rezeptor-Ligand-Wechselwirkungen

Secreted factors, membrane-tethered receptors, and their interacting partners are main regulators of cellular communication and initiation of signaling ...

A Fluorescence Fluctuation Spectroscopy Assay of Protein-Protein Interactions at Cell-Cell Contacts

A variety of biological processes involves cell-cell interactions, typically mediated by proteins that interact at the interface between neighboring cells. Of interest, only few assays are capable of specifically probing such interactions directly in living cells. Here, we present an assay to measure the binding of proteins expressed at the surfaces of neighboring cells, at cell-cell contacts. This assay consists of two steps: mixing of cells expressing the proteins of interest fused to different fluorescent proteins, followed by fluorescence fluctuation spectroscopy measurements at cell-cell contacts using a confocal laser scanning microscope. We demonstrate the feasibility of this assay in a biologically relevant context by measuring the interactions of the amyloid precursor-like protein 1 (APLP1) across cell-cell junctions. We provide detailed protocols on the data acquisition using fluorescence-based techniques (scanning fluorescence cross-correlation spectroscopy, cross-correlation number and brightness analysis) and the required instrument calibrations. Further, we discuss critical steps in the data analysis and how to identify and correct external, spurious signal variations, such as those due to photobleaching or cell movement.
In general, the presented assay is applicable to any homo- or heterotypic protein-protein interaction at cell-cell contacts, between cells of the same or different types and can be implemented on a commercial confocal laser scanning microscope. An important requirement is the stability of the system, which needs to be sufficient to probe diffusive dynamics of the proteins of interest over several minutes.

This protocol describes a fluorescence fluctuation spectroscopy-based approach to investigate interactions among proteins mediating cell-cell interactions, i.e. proteins localized in cell junctions, directly in living cells. We provide detailed guidelines on instrument calibration, data acquisition and analysis, including corrections to possible artefact sources.

Eine Fluoreszenz Fluktuation Spektroskopie Assay von Protein-Protein-Wechselwirkungen an den Zell-Zell-Kontakten

A variety of biological processes involves cell-cell interactions, typically mediated by proteins that interact at the interface between neighboring ...

Evaluation of Protein&#8211;Protein Interactions using an On-Membrane Digestion Technique

Numerous intracellular proteins physically interact in accordance with their intracellular and extracellular circumstances. Indeed, cellular functions largely depend on intracellular protein&#8211;protein interactions. Therefore, research regarding these interactions is indispensable to facilitating the understanding of physiologic processes. Co-precipitation of associated proteins, followed by mass spectrometry (MS) analysis, enables the identification of novel protein interactions. In this study, we have provided details of the novel technique of immunoprecipitation-liquid chromatography (LC)-MS/MS analysis combined with on-membrane digestion for the analysis of protein&#8211;protein interactions. This technique is suitable for crude immunoprecipitants and can improve the throughput of proteomic analyses. Tagged recombinant proteins were precipitated using specific antibodies; next, immunoprecipitants blotted onto polyvinylidene difluoride membrane pieces were subjected to reductive alkylation. Following trypsinization, the digested protein residues were analyzed using LC-MS/MS. Using this technique, we were able to identify several candidate associated proteins. Thus, this method is convenient and useful for the characterization of novel protein&#8211;protein interactions.

Here, we present a protocol for an on-membrane digestion technique for the preparation of samples for mass spectrometry. This technique facilitates the convenient analysis of protein&#8211;protein interactions.

Bewertung von Protein-Protein-Wechselwirkungen mit einer On-Membrane-Verdauungstechnik

Numerous intracellular proteins physically interact in accordance with their intracellular and extracellular circumstances. Indeed, cellular functions ...

Interactions with and Membrane Permeabilization of Brain Mitochondria by Amyloid Fibrils

A growing body of evidence indicates that membrane permeabilization, including internal membranes such as mitochondria, is a common feature and primary mechanism of amyloid aggregate-induced toxicity in neurodegenerative diseases. However, most reports describing the mechanisms of membrane disruption are based on phospholipid model systems, and studies directly targeting events occurring at the level of biological membranes are rare. Described here is a model for studying the mechanisms of amyloid toxicity at the membrane level. For mitochondrial isolation, density gradient medium is used to obtain preparations with minimal myelin contamination. After mitochondrial membrane integrity confirmation, the interaction of amyloid fibrils arising from &#945;-synuclein, bovine insulin, and hen egg white lysozyme (HEWL) with rat brain mitochondria, as an in vitro biological model, is investigated. The results demonstrate that treatment of brain mitochondria with fibrillar assemblies can cause different degrees of membrane permeabilization and ROS content enhancement. This indicates structure-dependent interactions between amyloid fibrils and mitochondrial membrane. It is suggested that biophysical properties of amyloid fibrils and their specific binding to mitochondrial membranes may provide explanations for some of these observations.

Provided here is a protocol for investigating the interactions between native form, prefibrillar, and mature amyloid fibrils of different peptides and proteins with mitochondria isolated from different tissues and various areas of the brain.

Wechselwirkungen mit und Membranpermeabilisierung des Gehirns Mitochondrien durch Amyloid Fibrils

A growing body of evidence indicates that membrane permeabilization, including internal membranes such as mitochondria, is a common feature and primary ...

Acyl-PEGyl Exchange Gel Shift Assay for Quantitative Determination of Palmitoylation of Brain Membrane Proteins

Activity-dependent alterations in the levels of synaptic AMPA receptors (AMPARs) within the postsynaptic density (PSD) is thought to represent a cellular mechanism for learning and memory. Palmitoylation regulates localization and function of many synaptic proteins including AMPA-Rs, auxiliary factors and synaptic scaffolds in an activity-dependent manner. We identified the synapse differentiation induced gene (SynDIG) family of four genes (SynDIG1-4) encoding brain-specific transmembrane proteins that associate with AMPARs and regulate synapse strength. SynDIG1 is palmitoylated at two cysteine residues located at positions 191 and 192 in the juxta-transmembrane region important for activity-dependent excitatory synapse development. Here, we describe an innovative biochemical approach, the acyl-PEGyl exchange gel shift (APEGS) assay, to investigate the palmitoylation state of any protein of interest and demonstrate its utility with the SynDIG family of proteins in mouse brain lysates.

Palmitoylation entails the incorporation of a 16-carbon palmitate moiety to cysteine residues of target proteins in a reversible manner. Here, we describe a biochemical approach, the acyl-PEGyl exchange gel shift (APEGS) assay, to investigate the palmitoylation state of any protein of interest in mouse brain lysates.

Acyl-PEGyl Exchange Gel Shift Assay zur quantitativen Bestimmung der Palmitoylierung von Gehirnmembranproteinen

Activity-dependent alterations in the levels of synaptic AMPA receptors (AMPARs) within the postsynaptic density (PSD) is thought to represent a cellular ...

Measuring Nucleotide Binding to Intact, Functional Membrane Proteins in Real Time

We have developed a method to measure binding of adenine nucleotides to intact, functional transmembrane receptors in a cellular or membrane environment. This method combines expression of proteins tagged with the fluorescent non-canonical amino acid ANAP, and FRET between ANAP and fluorescent (trinitrophenyl) nucleotide derivatives. We present examples of nucleotide binding to ANAP-tagged KATP ion channels measured in unroofed plasma membranes and excised, inside-out membrane patches under voltage clamp. The latter allows for simultaneous measurements of ligand binding and channel current, a direct readout of protein function. Data treatment and analysis are discussed extensively, along with potential pitfalls and artefacts. This method provides rich mechanistic insights into the ligand-dependent gating of KATP channels and can readily be adapted to the study of other nucleotide-regulated proteins or any receptor for which a suitable fluorescent ligand can be identified.

This protocol presents a method for measuring adenine nucleotide binding to receptors in real time in a cellular environment. Binding is measured as F&#246;rster resonance energy transfer (FRET) between trinitrophenyl nucleotide derivatives and protein labeled with a non-canonical, fluorescent amino acid.

Messung der Nukleotidbindung an intakte, funktionelle Membranproteine in Echtzeit

We have developed a method to measure binding of adenine nucleotides to intact, functional transmembrane receptors in a cellular or membrane environment. ...

Transverse Sectioning of Mature Rice (Oryza sativa L.) Kernels for Scanning Electron Microscopy Imaging Using Pipette Tips as Immobilization Support

Starch granules (SGs) exhibit different morphologies depending on the plant species, especially in the endosperm of the Poaceae family. Endosperm phenotyping can be used to classify genotypes based on SG morphotype using scanning electron microscopic (SEM) analysis. SGs can be visualized using SEM by slicing through the kernel (pericarp, aleurone layers, and endosperm) and exposing the organellar contents. Current methods require the rice kernel to be embedded in plastic resin and sectioned using a microtome or embedded in a truncated pipette tip and sectioned by hand using a razor blade. The former method requires specialized equipment and is time-consuming, while the latter introduces a new host of problems depending on rice genotype. Chalky rice varieties, particularly, pose a problem for this type of sectioning due to the friable nature of their endosperm tissue. Presented here is a technique for preparing translucent and chalky rice kernel sections for microscopy, requiring only pipette tips and a scalpel blade. Preparing the sections within the confines of a pipette tip prevents rice kernel endosperm from shattering (for translucent or &#8216;vitreous&#8217; phenotypes) and crumbling (for chalky phenotypes). Using this technique, endosperm cell patterning and the structure of intact SGs can be observed.

Transverse Sectioning of Mature Rice Oryza sativa L. Kernels for Scanning Electron Microscopy Imaging Using Pipette Tips as Immobilization Support

This protocol allows for the preparation of transverse sections of cereal seeds (e.g., rice) for the analysis of endosperm and starch granule morphology using scanning electron microscopy.

Querschnitt von reifem Reis (Oryza sativa L.) Kerne für die Rasterelektronenmikroskopie-Bildgebung mit Pipettenspitzen als Immobilisierungsunterstützung

Starch granules (SGs) exhibit different morphologies depending on the plant species, especially in the endosperm of the Poaceae family. Endosperm ...

Co-Translational Insertion of Membrane Proteins into Preformed Nanodiscs

Cell-free expression systems allow the tailored design of reaction environments to support the functional folding of even complex proteins such as membrane proteins. The experimental procedures for the co-translational insertion and folding of membrane proteins into preformed and defined membranes supplied as nanodiscs are demonstrated. The protocol is completely detergent-free and can generate milligrams of purified samples within one day. The resulting membrane protein/nanodisc samples can be used for a variety of functional studies and structural applications such as crystallization, nuclear magnetic resonance, or electron microscopy. The preparation of basic key components such as cell-free lysates, nanodiscs with designed membranes, critical stock solutions as well as the assembly of two-compartment cell-free expression reactions is described. Since folding requirements of membrane proteins can be highly diverse, a major focus of this protocol is the modulation of parameters and reaction steps important for sample quality such as critical basic reaction compounds, membrane composition of nanodiscs, redox and chaperone environment, or DNA template design. The whole process is demonstrated with the synthesis of proteorhodopsin and a G-protein coupled receptor.

Co-translational insertion into pre-formed nanodiscs makes it possible to study cell-free synthesized membrane proteins in defined lipid environments without contact with detergents. This protocol describes the preparation of essential system components and the critical parameters for improving expression efficiency and sample quality.

Erkennung von Waschmittel-Sensitive Interaktionen zwischen Membranproteine

Zusammenfassung

Weitere Videos entdecken

Kapitel in diesem Video

Scaffold Liposomen zu rekonstituieren Lipid-proximalen Protein-Protein-Wechselwirkungen

Verfahren zum Visualisieren und Analysieren Membran interagierender Proteine durch Transmissionselektronenmikroskopie

Extrazelluläre Protein-Microarray-Technologie für hohen Durchsatz-Erkennung von geringe Affinität-Rezeptor-Ligand-Wechselwirkungen

Eine Fluoreszenz Fluktuation Spektroskopie Assay von Protein-Protein-Wechselwirkungen an den Zell-Zell-Kontakten

Bewertung von Protein-Protein-Wechselwirkungen mit einer On-Membrane-Verdauungstechnik

Wechselwirkungen mit und Membranpermeabilisierung des Gehirns Mitochondrien durch Amyloid Fibrils

Acyl-PEGyl Exchange Gel Shift Assay zur quantitativen Bestimmung der Palmitoylierung von Gehirnmembranproteinen

Messung der Nukleotidbindung an intakte, funktionelle Membranproteine in Echtzeit

Querschnitt von reifem Reis (Oryza sativa L.) Kerne für die Rasterelektronenmikroskopie-Bildgebung mit Pipettenspitzen als Immobilisierungsunterstützung

Co-translationale Insertion von Membranproteinen in vorgeformte Nanoscheiben

Erkennung von Waschmittel-Sensitive Interaktionen zwischen Membranproteine

Zusammenfassung

Weitere Videos entdecken

Kapitel in diesem Video

Scaffold Liposomen zu rekonstituieren Lipid-proximalen Protein-Protein-Wechselwirkungen

Verfahren zum Visualisieren und Analysieren Membran interagierender Proteine ​​durch Transmissionselektronenmikroskopie

Extrazelluläre Protein-Microarray-Technologie für hohen Durchsatz-Erkennung von geringe Affinität-Rezeptor-Ligand-Wechselwirkungen

Eine Fluoreszenz Fluktuation Spektroskopie Assay von Protein-Protein-Wechselwirkungen an den Zell-Zell-Kontakten

Bewertung von Protein-Protein-Wechselwirkungen mit einer On-Membrane-Verdauungstechnik

Wechselwirkungen mit und Membranpermeabilisierung des Gehirns Mitochondrien durch Amyloid Fibrils

Acyl-PEGyl Exchange Gel Shift Assay zur quantitativen Bestimmung der Palmitoylierung von Gehirnmembranproteinen

Messung der Nukleotidbindung an intakte, funktionelle Membranproteine in Echtzeit

Querschnitt von reifem Reis (Oryza sativa L.) Kerne für die Rasterelektronenmikroskopie-Bildgebung mit Pipettenspitzen als Immobilisierungsunterstützung

Co-translationale Insertion von Membranproteinen in vorgeformte Nanoscheiben

Verfahren zum Visualisieren und Analysieren Membran interagierender Proteine durch Transmissionselektronenmikroskopie