Les travaux de recherche effectués dans le laboratoire a été financé par des subventions de la Fondation de la recherche - Flandre (FWO, les numéros de subvention G.0545.08 et G.0298.11), le Programme des pôles d&#39;activité interuniversitaire (Politique scientifique fédérale, numéro de subvention P6/28 et P7/13) et est intégré dans une communauté de recherche FWO-prise en charge. CDH est un chercheur post-doctoral de la Fondation de la recherche - Flandre (FWO). Les auteurs sont très reconnaissants à tous les membres actuels et anciens du Laboratoire de génétique moléculaire et de la signalisation cellulaire (KU Leuven), le Dr SP Srinivas (Indiana University School of Optometry, USA), le laboratoire du Dr Leybaert (Université de Gand) et de Dr. Vinken (VUB) qui a fourni discussions utiles, optimisé procédures ou ont été impliqués dans le développement d&#39;outils pour l&#39;étude des hemichannels connexine.

1. Isolement des cellules endothéliales de la cornée Avant de commencer: isoler les cellules des yeux neufs, provenant d&#39;un abattoir local, dès que possible après énucléation de l&#39;œil. Assurez-vous que l&#39;œil a été énucléé d&#39;une vache du maximales de 18 mois, à cinq minutes post mortem et conservées dans une solution saline équilibrée de Earle - solution d&#39;iode de 1% à 4 ° C pour le transport au laboratoire. <ol><li> Prenez l&#39;œil de la solution saline équilibrée de Earle - solution d&#39;iode à 1% et le placer dans une boîte de Pétri (100 x 20 mm). </li><li> Stériliser les yeux avec une solution contenant 70% d&#39;éthanol et rincer avec une solution saline équilibrée de Earle contenant 1% d&#39;iode. </li><li> A partir de cette étape, le travail sur une hotte stérile. Disséquer soigneusement la cornée de l&#39;œil et le placer dans une boîte de Pétri (35 x 10 mm) contenant une solution saline équilibrée de Earle, avec la couche de cellules épithéliales vers le haut. Retirez soigneusement sti de tissu restant irisll attachée à la cornée, si nécessaire. </li><li> Transférer la cornée à la solution saline équilibrée de Earle autre boîte de Pétri contenant de la couche de cellules endothéliales vers le haut et rincer deux fois avec une solution saline équilibrée de Earle. </li><li> Transférer la cornée avec la couche endothéliale vers le haut à un sablier, qui est un plat en forme de coupe, et le couvrir avec un milieu de croissance. Le milieu de croissance est constitué du milieu de Eagle modifié par Dulbecco contenant 25 mM de glucose, 10% de sérum de veau fœtal, 6,6% de L-glutamine, 2,5 pg / ml d&#39;amphotéricine-B et 1% mélange d&#39;antibiotiques antimycosiques contenant 10.000 unités / ml de pénicilline, 10.000 mg / ml de streptomycine et 25 pg / ml d&#39;amphotéricine B. </li><li> Retirer le support avec une pipette d&#39;aspiration. </li><li> Appliquer 300 ul d&#39;une solution de trypsine (0,5 g / L) à la couche endothéliale de la cornée (toutes les étapes qui comprennent la trypsine sont effectuées en utilisant la même concentration). </li><li> Placer le sablier contenant la cornée dans un plat de Petri couvert et le mettre dans le incubator pendant 30 min à 37 ° C et 5% de CO 2. </li><li> Grattez délicatement les cellules endothéliales loin de la cornée avec un feu poli en forme de crochet pipette Pasteur en verre dans une hotte stérile. </li><li> Sucer la solution contenant les cellules endothéliales et l&#39;ajouter à des flacons de culture (25 cm 2) contenant 4 ml de milieu de culture. </li><li> Appliquer 300 ul de milieu de croissance de la cornée et de répéter le raclage et ajouter la solution contenant les cellules endothéliales dans le flacon de culture. </li><li> Répétez cette dernière étape (1.11) une fois de plus. </li><li> Placer les flacons de culture contenant les cellules endothéliales de la cornée dans le milieu de culture à l&#39;étuve à 37 ° C et 5% de CO 2. </li><li> Après deux jours, ajouter 6 ml de milieu de culture. </li><li> Rafraîchir le milieu de croissance tous les deux jours. </li></ol> 2. Culture cellulaire <ol><li> Retirez le milieu de culture et laver les cellules deux fois avec une solution saline équilibrée de Earle, lorsque la confluence est atteinte (au sein about 10 jours après isolement). </li><li> Ajouter une solution de trypsine de 1,5 ml aux cellules pour les détacher et placer le ballon dans l&#39;incubateur (37 ° C, 5% CO 2) pendant 3 à 4 min. </li><li> Ajouter 12 ml de milieu de croissance. Introduire à la pipette du milieu à trois fois dans et hors de disperser les cellules et compter les cellules. </li><li> Ensemencer les cellules avec une fraction variable selon la densité cellulaire et les mettre dans l&#39;incubateur. Préparer deux lames bien cloisonnées (avec une surface de 4,2 cm 2) avec un nombre de cellules de cellules 165 000 (densité de cellule de 39 286 par cm 2). Préparer 80 cm 2 flacons de culture pour un nouveau passage à une densité de 6.250 par cm 2, et ajouter du milieu de culture frais jusqu&#39;à un volume total de 25 ml. </li><li> Actualisez la moyenne tous les deux jours. </li><li> Confluence de la couche de cellules est atteinte après 3 à 4 jours. Utiliser des cellules pour les expériences. </li><li> Lorsque la confluence de la couche de cellules dans les flacons est atteint, répétez les étapes 2.1 à 2.6. Cultures cellule à passage 2 peut être utilisé fou expériences. </li></ol> 3. La stimulation mécanique pour induire Calcium onde <ol><li> Chargez les cellules dans la diapositive chambré avec 10 uM Fluo-quatre heures dans une solution saline pendant 30 min tampon phosphate à 37 ° C en agitant doucement. </li><li> Retirez le Fluo-quatre heures solution, se laver les cellules cinq fois avec un tampon phosphate salin, incuber les cellules avec un tampon phosphate salin et laisser les cellules pendant au moins 5 min à température ambiante avant la mesure. </li><li> Excite à 488 nm avec laser argon et de l&#39;utilisation diviseur de faisceau HFT 488, collecter l&#39;émission de fluorescence à 530 nm en utilisant un filtre passe-haut émission LP 505, réglez le sténopé au minimum. Utilisez une immersion objectif 40X de pétrole (Air, 1,2 NA). Dans les expériences avec ARL-67156, utilisez un objectif 10X (Air, 0,3 NA). </li><li> Rechercher un domaine dans lequel les cellules sont confluentes sur le microscope confocal. </li><li> Position de la pipette de sorte qu&#39;il est à 45 ° par rapport à la glissière et chambré toucher la membrane cellulaire.Provoquer un court stimulation mécanique (≈ 1 seconde) à une seule cellule. La stimulation mécanique se compose d&#39;une déformation aiguë, de courte durée de la cellule de toucher moins de 1% de la membrane de la cellule avec une micropipette en verre (diamètre pointe &lt;1 um) couplé à un nanopositionneur de cristal piézo-électrique, actionné par un amplificateur qui est monté sur un micro-manipulateur. Les pipettes en verre sont fabriqués avec un extracteur de microélectrodes. Assurez-vous que le nanopositionneur est exploité par une tension comprise entre 0,2 et 1,5 V au cours de la stimulation mécanique. Une tension supérieure à 1,5 V peut entraîner des dommages cellulaires. Pour chaque type et état de la cellule, la tension optimale pour la stimulation mécanique sans endommager la cellule doit être soigneusement déterminé en appliquant une série de tensions d&#39;amorçage de faible (0,2 V) à grande (1,5 V) de tension. La tension est une mesure de la force de l&#39;excitation depuis cette tension détermine la contrainte mécanique et la tension qui sont appliqués à la membrane cellulaire. Lela force de la stimulation mécanique peut être calculée en multipliant la contrainte mécanique avec la surface. Depuis la fois la zone (&lt;3,14 um 2) et la contrainte mécanique est très faible, la force de l&#39;excitation mécanique est faible. (Notez que quand une cellule est endommagé, les fuites de fluorescence de la cellule et la cellule devient sombre.) </li><li> Mesurer les variations spatiales de la [Ca 2 +] i suite à une stimulation mécanique avec le microscope confocal. </li><li> Collecter et stocker des images. </li><li> Dessiner une région polygonale d&#39;intérêt pour définir la zone de surface totale de cellules sensibles (zone active, AA) en utilisant le logiciel du microscope confocal. </li></ol>

Les auteurs n&#39;ont rien à révéler.

Dans ce manuscrit, nous décrivons une méthode simple pour mesurer intercellulaire Ca 2 + propagation d&#39;ondes dans des monocouches de cellules endothéliales de la cornée bovine primaire en fournissant une stimulation mécanique localisée et contrôlée à l&#39;aide d&#39;une micropipette. Cellules stimulées mécaniquement réagissent avec une augmentation locale IP intracellulaire 3 et Ca 2 +, qui sont tous deux molécules de signalisation intracellulaires essentielles qui anim...

Communication intercellulaire et la signalisation sont essentiels pour la coordination des processus physiologiques en réponse à des agonistes extracellulaires au niveau du tissu et de 1,2 niveau entier organe. La façon la plus directe de la communication intercellulaire est créée par la présence de jonctions. Les jonctions lacunaires sont des plaques de canaux de jonctions lacunaires, qui sont des chaînes protéiques formés par l&#39;accueil en tête-à-tête de deux (Cx) hemichannels connexine de cellules adjacentes 3,4 (figure 1). Les jonctions lacunaires permettent le passage de petites molécules de signalisation avec un poids moléculaire de moins de 1,5 kDa, notamment Ca2 + ou IP 3 5, ce qui provoque et de modulation du Ca 2 + de la libération des réserves intracellulaires des cellules voisines 6 (figure 2). canaux des jonctions lacunaires sont strictement réglementées par les interactions entre protéines intra-et intermoléculaires et par des processus de signalisation cellulaire, comme la modification redox etphosphorylation 7. GJ faciliter la réponse coordonnée de cellules connectées, agissant ainsi comme un syncytium chimique et électrique. Par exemple, la propagation du potentiel d&#39;action cardiaque dans les myocytes auriculaires et ventriculaires est médiée par des canaux GJ Cx à base 85. Cx ont non seulement un rôle de canaux de jonctions lacunaires, mais aussi former hemichannels non appariés, fonctionnant ainsi comme des canaux dans les membranes de même pour les canaux ioniques réguliers 8-10 (Figure 1). Hémicanaux participent à la signalisation paracrines entre cellules voisines en contrôlant l&#39;échange d&#39;ions et molécules de signalisation entre l&#39;environnement intra-et extracellulaire. Dans de nombreux types de cellules (comme les cellules épithéliales, les cellules ostéoblastiques, les astrocytes, cellules endothéliales, etc) et des organes (comme le cerveau, le foie, la rétine, la cochlée et le système vasculaire), intercellulaire Ca 2 +-ondes sont fondamentales pour la coordination des réponses multicellulaires <sup&gt; 11. L&#39;augmentation des niveaux 2 + intracellulaire de Ca dans une certaine cellule ne sont pas limités à cette cellule, mais se propagent aux cellules voisines environnantes, établissant ainsi un intercellulaire Ca 2 +-ondes 12,13. Ces intercellulaire Ca 2 +-ondes sont importants pour la régulation physiologique normal de couches de cellules comme un syncytium et leur dérégulation a été associée à des processus physiopathologiques 11. Dans l&#39;endothélium cornéen et l&#39;épithélium, les différents groupes 14-24, y compris notre propre 25-33, a étudié les mécanismes et les rôles de la communication intercellulaire. Dans les cellules non-excitables, comme les cellules endothéliales de la cornée, deux modes distincts de communication intercellulaire surviennent 28,29, à savoir écart de jonction communication intercellulaire et de la communication intercellulaire paracrine. La communication intercellulaire par jonction implique un échange direct de molécules de signalisation via les jonctions gap 7. Gap jonctioncommunication intercellulaire internationale est essentielle pour le maintien de l&#39;homéostasie tissulaire, contrôle de la prolifération cellulaire, et d&#39;établir une réponse synchronisée au stress extracellulaire 10,34,35. Dans un certain nombre de pathologies, l&#39;écart couplage de jonction est réduite en raison de Cx défectueux, et affectant la présente écart de jonction communication intercellulaire 36. Ceci souligne l&#39;importance et l&#39;influence de la communication intercellulaire par jonction dans les organismes multicellulaires. Contrairement à la communication intercellulaire par jonction, la communication intercellulaire paracrine ne dépend pas de l&#39;apposition de cellule à cellule, car elle implique la libération de messagers extracellulaires diffusables (Figure 2). Différents types de molécules de signalisation sont libérés dans l&#39;espace extracellulaire par les cellules de signalisation. La molécule est alors transporté vers la cellule cible, où elle est détectée par une protéine réceptrice spécifique. Par la suite le complexe du signal du récepteur induit une réponse cellulaire, quiil est mis fin par le retrait du signal, l&#39;inactivation ou une désensibilisation. Lipophiles messagers extracellulaires de signalisation Sortie pénétrer la membrane et agissent sur des récepteurs intracellulaires. En revanche, les messagers hydrophiles ne traversent pas la membrane plasmique de la cellule de réponse, mais agissent comme un ligand qui se lie à-exprimés surface des protéines réceptrices, qui ensuite transmettent le signal vers le milieu intracellulaire. Trois grandes familles de protéines réceptrices de surface cellulaire participent à ce processus: canal ionique lié, lié à une enzyme et la protéine G liés. La molécule de messager libéré peut agir sur les récepteurs de la même cellule (autocrine), sur des cellules cibles à proximité (paracrine), ou sur les cellules cibles lointaines qui nécessitent le système circulatoire (endocrine). Dans de nombreux types de cellules, y compris endothélium cornéen 28,29, l&#39;ATP est l&#39;un des principaux facteurs hydrophiles, paracrines qui stimulent la propagation des intercellulaire Ca 2 +-ondes 37-40. DurING déformation mécanique, l&#39;hypoxie, l&#39;inflammation ou de la stimulation par divers agents, ATP peuvent être libérés à partir de cellules saines 41-44 en réponse à la contrainte de cisaillement, étirement, ou gonflement osmotique 44,45. Différents mécanismes ATP à libération prolongée ont été avancées, y compris l&#39;exocytose vésiculaire 44 et une pléthore de mécanismes de transport, tels que les cassettes (ABC) transporteurs de liaison ATP, canaux anioniques voltage-dépendants plasmiques 46, P2X7 canaux récepteurs 47,48, ainsi que connexine hemichannels 49-52 et pannexine hémicanaux 43,49,53. ATP extracellulaire peut être rapidement hydrolysé à l&#39;ADP, l&#39;AMP et l&#39;adénosine 54,55 par ectonucléotidases qui sont présents dans le milieu extracellulaire. L&#39;ATP extracellulaire libéré et son métabolite ADP 56 se propage par diffusion. L&#39;interaction ultérieure de ces nucléotides avec des récepteurs purinergiques dans les cellules voisines a été impliquée dans la propagation de intercellulaire Ca 2 +-ondes 28,37,51. Deux classes différentes de récepteurs purinergiques sont présents: l&#39;adénosine est le principal ligand naturel pour P1-purinorécepteurs, alors que les deux purine (ATP, ADP) et pyrimidiques (UTP, UDP) nucléotides agissent sur ​​la plupart P2-purinorécepteurs 57. Communication intercellulaire peut être étudiée par différentes méthodes telles que gratter chargement, transfert de colorant, uncaging locale d&#39;agonistes comme IP3 et Ca 2 +, la stimulation mécanique, etc. Nous décrivons ici l&#39;étude de Ca 2 + propagation d&#39;onde provoquée par une stimulation mécanique d&#39;une seule cellule. L&#39;avantage d&#39;étudier Ca 2 + propagation d&#39;ondes par une stimulation mécanique est qu&#39;il fournit un outil facile à quantifier la propagation de la Ca 2 +-onde au fil du temps et il permet de comparer quantitativement différents prétraitements des cellules. Dans l&#39;endothélium cornéen, les intercellulaire Ca 2 +-ondes permettent une coréponse coordonnée à partir de la monocouche, agissant par les présentes en tant que mécanisme de défense possible de l&#39;endothélium cornéen non régénératif aider l&#39;endothélium pour résister aux contraintes extracellulaire lors de la chirurgie intra-oculaire, ou par exposition à des médiateurs inflammatoires pendant rejet immunitaire ou uvéite 58,59.

<table border="1">
<tbody>
 <tr>
 <td>Name of Reagent/Material</td>
 <td>Company</td>
 <td>Catalog Number</td>
 <td>Column1</td>
 </tr>
 <tr>
 <td>Earle's Balanced Salt Solution (EBSS)</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>14155-048</td>
 <td></td>
 </tr>
 <tr>
 <td>Iodine</td>
 <td>Sigma-Aldrich (Deisenhofen, Germany)</td>
 <td>38060-1EA</td>
 <td></td>
 </tr>
 <tr>
 <td>Dulbecco's Modified Eagle's Medium (DMEM)</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>11960-044</td>
 <td></td>
 </tr>
 <tr>
 <td>L-glutamine (Glutamax)</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>35050-038</td>
 <td></td>
 </tr>
 <tr>
 <td>Amphotericin-B</td>
 <td>Sigma-Aldrich (Deisenhofen, Germany)</td>
 <td>A2942</td>
 <td></td>
 </tr>
 <tr>
 <td>Antibiotic-antimycotic mixture</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>15240-096</td>
 <td></td>
 </tr>
 <tr>
 <td>Trypsin</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>25300-054</td>
 <td></td>
 </tr>
 <tr>
 <td>Dulbecco's PBS</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>14190-091</td>
 <td></td>
 </tr>
 <tr>
 <td>Fluo-4 AM</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>F14217</td>
 <td></td>
 </tr>
 <tr>
 <td>ARL-67156 (6-N,N-Diethyl-b,g-dibromomethylene-D-ATP) </td>
 <td>Sigma-Aldrich (Deisenhofen, Germany)</td>
 <td>A265</td>
 <td></td>
 </tr>
 <tr>
 <td>Apyrase VI</td>
 <td>Sigma-Aldrich (Deisenhofen, Germany)</td>
 <td>A6410</td>
 <td></td>
 </tr>
 <tr>
 <td>Apyrase VII</td>
 <td>Sigma-Aldrich (Deisenhofen, Germany)</td>
 <td>A6535</td>
 <td></td>
 </tr>
 <tr>
 <td>Gap26 (VCYDKSFPISHVR)</td>
 <td>Custom peptide synthesis</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>Gap27 (SRPTEKTIFII)</td>
 <td>Custom peptide synthesis</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>Control Peptide (SRGGEKNVFIV)</td>
 <td>Custom peptide synthesis</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>siRNA1 Cx43 (sense: 5'GAAGGAGGAGGAACU-CAAAdTdT) </td>
 <td>Annealed siRNA was purchased at Eurogentec (Luik, Belgium)</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>siRNA2 Cx43 (sense: 5'CAAUUCUUCCUGCCGCAAUdTdT) </td>
 <td>Annealed siRNA was purchased at Eurogentec (Luik, Belgium)</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>siRNA scramble: scrambled sequence of siCx43-1 (sense: 5'GGUAAACG-GAACGAGAAGAdTdT) </td>
 <td>Annealed siRNA was purchased at Eurogentec (Luik, Belgium)</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>TAT-L2 (TAT- DGANVDMHLKQIEIKKFKYGIEEHGK)</td>
 <td>Thermo Electron (Ulm, Germany)</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>TAT-L2-H126K/I130N (TAT-DGANVDMKLKQNEIKKFKYGIEEHGK) </td>
 <td>Thermo Electron (Ulm, Germany)</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td></td>
 <td></td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>Two chambered glass slides</td>
 <td>Laboratory-Tek Nunc (Roskilde, Denmark)</td>
 <td>155380</td>
 <td></td>
 </tr>
 <tr>
 <td>Confocal microscope </td>
 <td>Carl Zeiss Meditec (Jena, Germany)</td>
 <td>LSM510</td>
 <td></td>
 </tr>
 <tr>
 <td>Piezoelectric crystal nanopositioner (Piezo Flexure NanoPositioner)</td>
 <td>PI Polytech (Karlsruhe, Germany)</td>
 <td>P-280</td>
 <td></td>
 </tr>
 <tr>
 <td>HVPZT-amplifier</td>
 <td>PI Polytech (Karlsruhe, Germany)</td>
 <td>E463 HVPZT-amplifier</td>
 <td></td>
 </tr>
 <tr>
 <td>Glass tubes (glass replacement 3.5 nanoliter)</td>
 <td>World Precision Instruments, Inc. Sarasota, Florida, USA</td>
 <td>4878</td>
 <td></td>
 </tr>
 <tr>
 <td>Microelectrode puller </td>
 <td>Zeitz Instrumente (Munchen, Germany)</td>
 <td>WZ DMZ-Universal Puller</td>
 <td></td>
 </tr>
</tbody>
 </table>

mechanical stimulation-induced calcium wave propagation in cell monolayers: the example of bovine corneal endothelial cells

Communication intercellulaire est essentiel pour la coordination des processus physiologiques entre les cellules dans une variété d&#39;organes et de tissus, y compris le cerveau, le foie, la rétine, la cochlée et le système vasculaire. Dans un cadre expérimental, intercellulaire Ca 2 +-ondes peut être obtenue en appliquant un stimulus mécanique à une seule cellule. Cela conduit à la libération des molécules de signalisation intracellulaire IP 3 et Ca 2 + qui initier la propagation de la Ca 2 +-onde concentrique de la cellule stimulée mécaniquement les cellules voisines. Les principales voies moléculaires qui contrôlent intercellulaire Ca 2 + propagation d&#39;ondes sont fournis par des canaux des jonctions lacunaires par le transfert direct de IP 3 et par hemichannels par la libération d&#39;ATP. Identification et caractérisation des propriétés et la régulation des différents isoformes connexine et pannexine les canaux et les hémicanaux de jonction gap sont autorisés par le quantification de la propagation de la Ca 2 + intracellulaire-ondes, siRNA, et l&#39;utilisation d&#39;inhibiteurs de canaux et hémicanaux de jonction gap. Ici, nous décrivons une méthode pour mesurer intercellulaire Ca 2 +-ondes dans des monocouches de cellules endothéliales de la cornée primaires chargé de Fluo4-AM en réponse à un stimulus mécanique contrôlée et localisée provoquée par une déformation aiguë, de courte durée de la cellule à la suite toucher de la membrane de la cellule avec une micropipette de verre micromanipulateur contrôlé avec un diamètre de pointe de moins de 1 um. Nous décrivons également l&#39;isolement des cellules endothéliales de la cornée bovine primaire et son utilisation comme système modèle pour évaluer l&#39;activité Cx43-hemichannel comme la force entraîné pour intercellulaire Ca 2 +-ondes à travers la libération de l&#39;ATP. Enfin, nous discutons de l&#39;utilisation, les avantages, les limites et les variantes de cette méthode dans le cadre du canal de jonction d&#39;espace et la recherche de hemichannel.

Toutes les expériences sont réalisées en conformité avec toutes les directives, les règlements et les organismes de réglementation et le protocole en démonstration est effectuée sous la direction et l&#39;approbation du soin des animaux et le comité de l&#39;utilisation de la KU Leuven. Dans les cellules endothéliales de la cornée bovine (BCEC), les jonctions fonctionnels sont exprimés et à la fois espace de jonction communication intercellulaire et de la communication intercell...

Watch this Scientific Journal Video about Mechanical Stimulation-induced Calcium Wave Propagation in Cell Monolayers: The Example of Bovine Corneal Endothelial Cells at JoVE.com

Mechanical Stimulation-induced Calcium Wave Propagation in Cell Monolayers: The Example of Bovine Corneal Endothelial Cells

Ca intercellulaire<sup&gt; 2 +</sup&gt;-Ondes sont entraînés par des chaînes et hémicanaux de jonction gap. Ici, nous décrivons une méthode pour mesurer intercellulaire Ca<sup&gt; 2 +</sup&gt;-Ondes dans des monocouches de cellules en réponse à un stimulus mécanique seule cellule locale et son application à l&#39;étude des propriétés et la régulation des canaux et hémicanaux de jonction gap.

La stimulation mécanique induite par le calcium propagation des ondes dans des monocouches de cellules: l&#39;exemple de bovins cellules endothéliales de la cornée

Intercellular communication is essential for the coordination of physiological processes between cells in a variety of organs and tissues, including the ...

mechanical-stimulation-induced-calcium-wave-propagation-cell

Research

JoVE Journal

Biology

16.1K vues.  KU Leuven. Ca intercellulaire 2 +-Ondes sont entraînés par des chaînes et hémicanaux de jonction gap. Ici, nous décrivons une méthode pour mesurer intercellulaire Ca 2 +-Ondes dans des monocouches de cellules en réponse à un stimulus mécanique seule cellule locale et son application à l'étude des propriétés et la régulation des canaux et hémicanaux de jonction gap.

Vidéo: Mechanical Stimulation-induced Calcium Wave Propagation in Cell Monolayers: The Example of Bovine Corneal Endothelial Cells

Propagation of Human Embryonic Stem (ES) Cells

Propagation of Human Embryonic Stem ES Cells

Propagation des souches embryonnaires humaines (ES) Cellules

Recherche

Biologie

Isolation and Large Scale Expansion of Adult Human Endothelial Colony Forming Progenitor Cells

This paper introduces a novel recovery strategy for endothelial colony forming progenitor cells (ECFCs) from heparinized but otherwise unmanipulated adult human peripheral blood within a mean of 12 days. After large scale expansion &gt;1x108 ECFCs can be obtained for further tests. Advantageously by using pHPL the contact of human cells with bovine serum antigens can be excluded. By flow cytometry and immunohistochemistry the isolated cells can be characterized as ECFC and their in vitro functionality to form vascular like structures can be tested in a matrigel assay. Further these cells can be subcutaneously injected in a mouse model to form functional, perfused vessels in vivo. After long term expansion and cryopreservation proliferation, function and genomic stability appear to be preserved. 3,4
This animal-protein free isolation and expansion method is easily applicable to generate a large quantity of ECFCs.

Endothelial colony forming progenitor cells (ECFCs) are a promising tool to study vascular homeostasis and repair.1,2 This paper introduces a novel animal-serum free method for isolation and expansion of ECFC from heparinised adult human peripheral blood with pooled human platelet lysate (pHPL) diminishing the risk of anti-bovine immunisation.

L&#39;isolement et expansion à grande échelle des cellules adultes humaines Colony Forming progénitrices endothéliales

This paper introduces a novel recovery strategy for endothelial colony forming progenitor cells (ECFCs) from heparinized but otherwise unmanipulated adult ...

Study of the Actin Cytoskeleton in Live Endothelial Cells Expressing GFP-Actin

The microvascular endothelium plays an important role as a selectively permeable barrier to fluids and solutes. The adhesive junctions between endothelial cells regulate permeability of the endothelium, and many studies have indicated the important contribution of the actin cytoskeleton to determining junctional integrity1-5. A cortical actin belt is thought to be important for the maintenance of stable junctions1, 2, 4, 5. In contrast, actin stress fibers are thought to generate centripetal tension within endothelial cells that weakens junctions2-5. Much of this theory has been based on studies in which endothelial cells are treated with inflammatory mediators known to increase endothelial permeability, and then fixing the cells and labeling F-actin for microscopic observation. However, these studies provide a very limited understanding of the role of the actin cytoskeleton because images of fixed cells provide only snapshots in time with no information about the dynamics of actin structures5. 
Live-cell imaging allows incorporation of the dynamic nature of the actin cytoskeleton into the studies of the mechanisms determining endothelial barrier integrity. A major advantage of this method is that the impact of various inflammatory stimuli on actin structures in endothelial cells can be assessed in the same set of living cells before and after treatment, removing potential bias that may occur when observing fixed specimens. Human umbilical vein endothelial cells (HUVEC) are transfected with a GFP-&beta;-actin plasmid and grown to confluence on glass coverslips. Time-lapse images of GFP-actin in confluent HUVEC are captured before and after the addition of inflammatory mediators that elicit time-dependent changes in endothelial barrier integrity. These studies enable visual observation of the fluid sequence of changes in the actin cytoskeleton that contribute to endothelial barrier disruption and restoration. 
Our results consistently show local, actin-rich lamellipodia formation and turnover in endothelial cells. The formation and movement of actin stress fibers can also be observed. An analysis of the frequency of formation and turnover of the local lamellipodia, before and after treatment with inflammatory stimuli can be documented by kymograph analyses. These studies provide important information on the dynamic nature of the actin cytoskeleton in endothelial cells that can used to discover previously unidentified molecular mechanisms important for the maintenance of endothelial barrier integrity.

Microscopic imaging of live endothelial cells expressing GFP-actin allows characterization of dynamic changes in cytoskeletal structures. Unlike techniques that use fixed specimens, this method provides a detailed assessment of temporal changes in the actin cytoskeleton in the same cells before, during, and after various physical, pharmacological, or inflammatory stimuli.

Étude du cytosquelette d&#39;actine dans les cellules endothéliales en direct exprimant la GFP-actine

The microvascular endothelium plays an important role as a selectively permeable barrier to fluids and solutes. The adhesive junctions between endothelial ...

Assessment of Calcium Sparks in Intact Skeletal Muscle Fibers

Maintaining homeostatic Ca2+ signaling is a fundamental physiological process in living cells. Ca2+ sparks are the elementary units of Ca2+ signaling in the striated muscle fibers that appear as highly localized Ca2+ release events mediated by ryanodine receptor (RyR) Ca2+ release channels on the sarcoplasmic reticulum (SR) membrane. Proper assessment of muscle Ca2+ sparks could provide information on the intracellular Ca2+&#160;handling properties of healthy and diseased striated muscles. Although Ca2+ sparks events are commonly seen in resting cardiomyocytes, they are rarely observed in resting skeletal muscle fibers; thus there is a need for methods to generate and analyze sparks in skeletal muscle fibers.
Detailed here is an experimental protocol for measuring Ca2+ sparks in isolated flexor digitorm brevis (FDB) muscle fibers using fluorescent Ca2+ indictors and laser scanning confocal microscopy. In this approach, isolated FDB fibers are exposed to transient hypoosmotic stress followed by a return to isotonic physiological solution. Under these conditions, a robust Ca2+ sparks response is detected adjacent to the sarcolemmal membrane in young healthy FDB muscle fibers. Altered Ca2+ sparks response is detected in dystrophic or aged skeletal muscle fibers. This approach has recently demonstrated that membrane-delimited signaling involving cross-talk between inositol (1,4,5)-triphosphate receptor (IP3R) and RyR contributes to Ca2+ spark activation in skeletal muscle. In summary, our studies using osmotic stress induced Ca2+ sparks showed that this intracellular response reflects a muscle signaling mechanism in physiology and aging/disease states, including mouse models of muscle dystrophy (mdx mice) or amyotrophic lateral sclerosis (ALS model).

Described here is a method to directly measure calcium sparks, the elementary units of Ca2+ release from sarcoplasmic reticulum&#160;in intact skeletal muscle fibers. This method utilizes osmotic-stress-mediated triggering of Ca2+ release from ryanodine receptor in isolated muscle fibers. The dynamics and homeostatic capacity of intracellular Ca2+ signaling can be employed to assess muscle function in health and disease.

Évaluation de calcium Sparks dans intactes les fibres musculaires squelettiques

Maintaining homeostatic Ca2+ signaling is a fundamental physiological process in living cells. Ca2+ sparks are the elementary units of Ca2+ signaling in ...

Endothelial Cell Tube Formation Assay for the In Vitro Study of Angiogenesis

Angiogenesis is a vital process for normal tissue development and wound healing, but is also associated with a variety of pathological conditions. Using this protocol, angiogenesis may be measured in vitro in a fast, quantifiable manner. Primary or immortalized endothelial cells are mixed with conditioned media and plated on basement membrane matrix. The endothelial cells form capillary like structures in response to angiogenic signals found in conditioned media. The tube formation occurs quickly with endothelial cells beginning to align themselves within 1&#160;hr and lumen-containing tubules beginning to appear within 2 hr. Tubes can be visualized using a phase contrast inverted microscope, or the cells can be treated with calcein AM prior to the assay and tubes visualized through fluorescence or confocal microscopy. The number of branch sites/nodes, loops/meshes, or number or length of tubes formed can be easily quantified as a measure of in vitro angiogenesis. In summary, this assay can be used to identify genes and pathways that are involved in the promotion or inhibition of angiogenesis in a rapid, reproducible, and quantitative manner.

Endothelial Cell Tube Formation Assay for the In Vitro Study of Angiogenesis

The tube formation assay is a fast, quantifiable method for measuring in vitro angiogenesis. Endothelial cells are combined with conditioned media and plated on basement membrane extract. Tube formation occurs within hours and newly formed tubules easily quantified.

Des cellules endothéliales Tube Formation test pour la<em&gt; In Vitro</em&gt; Etude de l&#39;angiogenèse

Angiogenesis is a vital process for normal tissue development and wound healing, but is also associated with a variety of pathological conditions. Using ...

Measuring the Osmotic Water Permeability Coefficient (Pf) of Spherical Cells: Isolated Plant Protoplasts as an Example

Studying AQP regulation mechanisms is crucial for the understanding of water relations at both the cellular and the whole plant levels. Presented here is a simple and very efficient method for the determination of the osmotic water permeability coefficient (Pf) in plant protoplasts, applicable in principle also to other spherical cells such as frog oocytes. The first step of the assay is the isolation of protoplasts from the plant tissue of interest by enzymatic digestion into a chamber with an appropriate isotonic solution. The second step consists of an osmotic challenge assay: protoplasts immobilized on the bottom of the chamber are submitted to a constant perfusion starting with an isotonic solution and followed by a hypotonic solution. The cell swelling is video recorded. In the third step, the images are processed offline to yield volume changes, and the time course of the volume changes is correlated with the time course of the change in osmolarity of the chamber perfusion medium, using a curve fitting procedure written in Matlab (the &#8216;PfFit&#8217;), to yield Pf.

Measuring the Osmotic Water Permeability Coefficient Pf of Spherical Cells: Isolated Plant Protoplasts as an Example

Measuring the osmotic water permeability coefficient (Pf) of cells can help understand the regulatory mechanisms of aquaporins (AQPs). Pf determination in spherical plant cell protoplasts presented here involves protoplasts isolation and numerical analysis of their initial rate of volume change as a result of an osmotic challenge during constant bath perfusion.

La mesure de la perméabilité à l&#39;eau Coefficient osmotique (P<sub&gt; F</sub&gt;) Des cellules sphériques: protoplastes de plantes isolées comme un exemple

Studying AQP regulation mechanisms is crucial for the understanding of water relations at both the cellular and the whole plant levels. Presented here is ...

Isolation of Murine Valve Endothelial Cells

Normal valve structures consist of stratified layers of specialized extracellular matrix (ECM) interspersed with valve interstitial cells (VICs) and surrounded by a monolayer of valve endothelial cells (VECs). VECs play essential roles in establishing the valve structures during embryonic development, and are important for maintaining life-long valve integrity and function. In contrast to a continuous endothelium over the surface of healthy valve leaflets, VEC disruption is commonly observed in malfunctioning valves and is associated with pathological processes that promote valve disease and dysfunction. Despite the clinical relevance, focused studies determining the contribution of VECs to development and disease processes are limited. The isolation of VECs from animal models would allow for cell-specific experimentation. VECs have been isolated from large animal adult models but due to their small population size, fragileness, and lack of specific markers, no reports of VEC isolations in embryos or adult small animal models have been reported. Here we describe a novel method that allows for the direct isolation of VECs from mice at embryonic and adult stages. Utilizing the Tie2-GFP reporter model that labels all endothelial cells with Green Fluorescent Protein (GFP), we have been successful in isolating GFP-positive (and negative) cells from the semilunar and atrioventricular valve regions using fluorescence activated cell sorting (FACS). Isolated GFP-positive VECs are enriched for endothelial markers, including CD31 and von Willebrand Factor (vWF), and retain endothelial cell expression when cultured; while, GFP-negative cells exhibit molecular profiles and cell shapes consistent with VIC phenotypes. The ability to isolate embryonic and adult murine VECs allows for previously unattainable molecular and functional studies to be carried out on a specific valve cell population, which will greatly improve our understanding of valve development and disease mechanisms.

The ability to isolate heart valve endothelial cells (VECs) is critical for understanding mechanisms of valve development, maintenance, and disease. Here we describe the isolation of VECs from embryonic and adult Tie2-GFP mice using FACS that will allow for studies determining the contribution of VECs in developmental and disease processes.

Isolement des cellules endothéliales murines Valve

Normal valve structures consist of stratified layers of specialized extracellular matrix (ECM) interspersed with valve interstitial cells (VICs) and ...

Quantitation of Endothelial Cell Adhesiveness In Vitro

One of the cardinal processes of inflammation is the infiltration of immune cells from the lumen of the blood vessel to the surrounding tissue. This occurs when endothelial cells, which line blood vessels, become adhesive to circulating immune cells such as monocytes. In vitro measurement of this adhesiveness has until now been done by quantifying the total number of monocytes that adhere to an endothelial layer either as a direct count or by indirect measurement of the fluorescence of adherent monocytes. While such measurements do indicate the average adhesiveness of the endothelial cell population, they are confounded by a number of factors, such as cell number, and do not reveal the proportion of endothelial cells that are actually adhesive. Here we describe and demonstrate a method which allows the enumeration of adhesive cells within a tested population of endothelial monolayer. Endothelial cells are grown on glass coverslips and following desired treatment are challenged with monocytes (that may be fluorescently labeled). After incubation, a rinsing procedure, involving multiple rounds of immersion and draining, the cells are fixed. Adhesive endothelial cells, which are surrounded by monocytes are readily identified and enumerated, giving an adhesion index that reveals the actual proportion of endothelial cells within the population that are adhesive.

Quantitation of Endothelial Cell Adhesiveness In Vitro

We report an in vitro method that allows the quantitation of the actual number of adhesive cells within an endothelial cell monolayer.

La quantification des cellules endothéliales adhésivité<em&gt; In Vitro</em

One of the cardinal processes of inflammation is the infiltration of immune cells from the lumen of the blood vessel to the surrounding tissue. This ...

High-resolution Time-lapse Imaging and Automated Analysis of Microtubule Dynamics in Living Human Umbilical Vein Endothelial Cells

The physiological process by which new vasculature forms from existing vasculature requires specific signaling events that trigger morphological changes within individual endothelial cells (ECs). These processes are critical for homeostatic maintenance such as wound healing, and are also crucial in promoting tumor growth and metastasis. EC morphology is defined by the organization of the cytoskeleton, a tightly regulated system of actin and microtubule (MT) dynamics that is known to control EC branching, polarity and directional migration, essential components of angiogenesis. To study MT dynamics, we used high-resolution fluorescence microscopy coupled with computational image analysis of fluorescently-labeled MT plus-ends to investigate MT growth dynamics and the regulation of EC branching morphology and directional migration. Time-lapse imaging of living Human Umbilical Vein Endothelial Cells (HUVECs) was performed following transfection with fluorescently-labeled MT End Binding protein 3 (EB3) and Mitotic Centromere Associated Kinesin (MCAK)-specific cDNA constructs to evaluate effects on MT dynamics. PlusTipTracker software was used to track EB3-labeled MT plus ends in order to measure MT growth speeds and MT growth lifetimes in time-lapse images. This methodology allows for the study of MT dynamics and the identification of how localized regulation of MT dynamics within sub-cellular regions contributes to the angiogenic processes of EC branching and migration.

Protocols for Human Umbilical Vein Endothelial Cell (HUVEC) culture, transient transfection of fluorescently-labeled markers of microtubule growth, live-cell imaging and automated analysis of interphase microtubule growth dynamics are detailed.

Haute résolution Time-lapse d&#39;imagerie et d&#39;analyse automatisée des microtubules Dynamics Living ombilicale humaine Cellules endothéliales de veine

The physiological process by which new vasculature forms from existing vasculature requires specific signaling events that trigger morphological changes ...

A Graphical User Interface for Software-assisted Tracking of Protein Concentration in Dynamic Cellular Protrusions

Filopodia are dynamic, finger-like cellular protrusions associated with migration and cell-cell communication. In order to better understand the complex signaling mechanisms underlying filopodial initiation, elongation and subsequent stabilization or retraction, it is crucial to determine the spatio-temporal protein activity in these dynamic structures. To analyze protein function in filopodia, we recently developed a semi-automated tracking algorithm that adapts to filopodial shape-changes, thus allowing parallel analysis of protrusion dynamics and relative protein concentration along the whole filopodial length. Here, we present a detailed step-by-step protocol for optimized cell handling, image acquisition and software analysis. We further provide instructions for the use of optional features during image analysis and data representation, as well as troubleshooting guidelines for all critical steps along the way. Finally, we also include a comparison of the described image analysis software with other programs available for filopodia quantification. Together, the presented protocol provides a framework for accurate analysis of protein dynamics in filopodial protrusions using image analysis software.

We present a software solution for semi-automated tracking of relative protein concentration along the length of dynamic cellular protrusions.

Une interface utilisateur graphique pour le suivi assisté par logiciel de la concentration de protéines dans les protrusions cellulaires dynamiques

Filopodia are dynamic, finger-like cellular protrusions associated with migration and cell-cell communication. In order to better understand the complex ...