Forschungsarbeiten im Labor durchgeführt wurde durch Zuschüsse aus dem Forschungsgemeinschaft - Flandern (FWO; Zuschuss Zahlen G.0545.08 und G.0298.11), der Interuniversity Attraction Poles Program (Belgian Science Policy; Grantnummer P6/28 und P7/13) und wird in einer FWO-gestützte Forschung eingebettet. CDH ist ein Post-Doc-Stipendiat der Forschungsgemeinschaft - Flandern (FWO). Die Autoren sind sehr dankbar für alle gegenwärtigen und ehemaligen Mitgliedern des Laboratory of Molecular and Cellular Signaling (KU Leuven), Dr. Srinivas SP (Indiana University School of Optometrie, USA), das Labor von Dr. Leybaert (Universität Gent) und der Dr. Vinken (VUB), die hilfreichen Diskussionen vorgesehen, optimierte Verfahren oder wurden in der Entwicklung von Werkzeugen für die Studie von Connexin hemichannels beteiligt.

1. Isolierung von Endothelzellen Bevor Sie beginnen: Isolieren Sie die Zellen aus den frischen Augen, von einem lokalen Schlachthof, so bald wie möglich nach enucleating das Auge erhalten. Stellen Sie sicher, dass das Auge von einer Kuh von maximal 18 Monate alt, nur fünf Minuten post mortem und konserviert in Balanced Salt Solution Earle wurde entkernt - 1% Jod-Lösung bei 4 ° C für den Transport zum Labor. <ol><li> Nehmen Sie das Auge aus der Balanced Salt Solution Earle - 1% Jod-Lösung und legen Sie sie in eine Petrischale (100 x 20 mm). </li><li> Sterilisieren das Auge mit einer Lösung, die 70% Ethanol und spülen Sie mit Balanced Salt Solution Earle mit 1% Jod. </li><li> Von diesem Schritt an, in einem sterilen Abzug arbeiten. Sorgfältig sezieren die Hornhaut aus dem Auge und legen Sie sie in einer Petrischale (35 x 10 mm) mit Earle-Balanced Salt Solution mit dem Epithelzellschicht nach oben. Entfernen Sie vorsichtig das restliche Irisgewebe still der Hornhaut angebracht, wenn nötig. </li><li> Übertragen Sie die Hornhaut Balanced Salt anderen Earle-Lösung enthält Petrischale mit dem Endothelzellschicht nach oben und spülen Sie zweimal mit Balanced Salt Solution Earle. </li><li> Übertragen Sie die Hornhaut mit dem Endothel nach oben in eine Sanduhr, die einen schalenförmigen Gericht ist, und bedecken Sie es mit Nährmedium. Das Nährmedium besteht aus Dulbeccos modifiziertem Eagle-Medium mit 25 mM Glukose, 10% fötales Rinderserum, 6,6% L-Glutamin, 2,5 ug / ml Amphotericin B und 1% Antibiotika-Antimykotika-Mischung, die 10.000 Einheiten / ml Penicillin, 10.000 pg / ml Streptomycin und 25 ug / ml Amphotericin B. </li><li> Entfernen Sie das Medium mit einem Saugpipette. </li><li> Bewerben 300 ul einer Trypsin-Lösung (0,5 g / L) auf die endotheliale Schicht der Hornhaut (all die Schritte, die Trypsin enthalten sind fertig mit der gleichen Konzentration). </li><li> Legen Sie die Sanduhr, die die Hornhaut in einem abgedeckten Petrischale und steckte es in die incubator für 30 min bei 37 ° C und 5% CO 2. </li><li> Vorsichtig kratzen die Endothelzellen von der Hornhaut mit einem feuerpolierten hakenförmigen Pasteurpipette aus Glas in einer sterilen Haube. </li><li> Saugen Sie die Lösung, die die Endothelzellen und fügen Sie ihn in Kulturflaschen (25 cm 2) mit 4 ml Kulturmedium. </li><li> Bewerben 300 ul Wachstumsmedium auf die Hornhaut und wiederholen Sie den Schaben und fügen Sie die Lösung, die die Endothelzellen der Kulturflasche. </li><li> Wiederholen Sie diesen letzten Schritt (1.11) noch einmal. </li><li> Legen Sie den Kulturflaschen mit den Endothelzellen in das Nährmedium im Brutschrank bei 37 ° C und 5% CO 2. </li><li> Nach zwei Tagen, 6 ml Kulturmedium. </li><li> Aktualisieren Sie die Wachstumsmedium jeden zweiten Tag. </li></ol> 2. Cell Culture <ol><li> Entfernen Sie das Kulturmedium und die Zellen zweimal mit Balanced Salt Solution Earle, wenn Konfluenz erreicht ist (max. About 10 Tage nach Isolation). </li><li> 1,5 ml Trypsin-Lösung zu den Zellen, um sie zu lösen und der Kolben wird in den Inkubator (37 ° C, 5% CO 2) für 3 bis 4 min. </li><li> In 12 ml Wachstumsmedium. Pipettieren die mittel dreimal in und aus, um die Zellen verteilen und zählen Sie die Zellen. </li><li> Seed die Zellen mit einem variablen Anteil in Abhängigkeit von der Zelldichte und steckte sie in den Inkubator. Bereiten Sie zwei gut chambered Dias (mit einer Fläche von 4,2 cm 2) mit einer Zellzahl von 165.000 Zellen (Zelldichte 39.286 pro cm 2). Bereiten 80 cm 2 Kulturflaschen für eine neue Stelle bei einer Dichte von 6,250 pro cm 2, und fügen Sie frisches Kulturmedium bis zu einem Gesamtvolumen von 25 ml. </li><li> Aktualisieren Sie die Medium alle zwei Tage. </li><li> Konfluenz der Zellschicht wird nach 3 bis 4 Tagen erreicht. Verwenden Zellen für Experimente. </li><li> Bei Konfluenz der Zellschicht in den Kolben erreicht wird, die Schritte 2.1 bis 2.6. Zellkulturen bis zu Passage 2 kann f verwendet werdenoder Experimente. </li></ol> 3. Mechanische Stimulation zur Induktion Calcium Welle <ol><li> Legen Sie die Zellen in der Kammer-Objektträger mit 10 uM Fluo-4 AM in Phosphat-gepufferter Salzlösung für 30 min bei 37 ° C unter leichtem Schütteln. </li><li> Entfernen Sie die Fluo-4 AM Lösung, waschen Sie die Zellen fünfmal mit Phosphat-gepufferte Kochsalzlösung, brüten die Zellen mit Phosphat-gepufferter Salzlösung und lassen die Zellen für mindestens 5 min bei Raumtemperatur vor der Messung. </li><li> Excite bei 488 nm mit Argon-Laser und Nutzung Strahlteiler HFT 488, sammeln die Fluoreszenzemission bei 530 nm mit einem Langpass Emission Filter LP 505, setzen Sie die Lochkamera mindestens. Verwenden Sie eine Öl-Immersion 40X-Objektiv (Air, 1.2 NA). In Experimenten mit ARL-67156, verwenden Sie einen 10X-Objektiv (Air, 0,3 NA). </li><li> Suche nach einem Bereich, in dem die Zellen konfluent auf dem konfokalen Mikroskop. </li><li> Position der Pipette, so dass es bei 45 ° in Bezug auf die Kammern Rutsche und Berühren der Zellmembran.Provozieren eine kurze (≈ 1 sec) mechanische Stimulation zu einer einzigen Zelle. Die mechanische Stimulation besteht aus einer akuten und der Kurz-bleibende Verformung der Zelle berühren, weniger als 1% der Zellmembran mit einer Glas-Mikropipette (Spitzendurchmesser &lt;1 um), die mit einem piezoelektrischen Kristall Nanopositionierer, über einen Verstärker, der betrieben angebracht an einem Mikro-Manipulator. Die Glasmikropipetten sind mit einer Mikroelektrode Abzieher gemacht. Stellen Sie sicher, dass die Nanopositionierer durch eine Spannung zwischen 0,2 und 1,5 V ist bei der mechanischen Stimulation betrieben. Eine höhere Spannung als 1,5 V kann in der Zelle führen. Für jede Zelle Art und Zustand, muss die optimale Spannung für mechanische Stimulation ohne Zellschäden sorgfältig durch Anwendung einer Reihe von Spannungen ab Low (0,2 V) bis hoch (1,5 V) Spannung bestimmt werden. Die Spannung ist ein Maß für die Kraft der Stimulation da diese Spannung die mechanischen Spannungen und Dehnungen, die auf der Zellmembran angewendet werden. DieKraft der mechanischen Stimulation kann durch Multiplizieren der mechanischen Beanspruchung mit der Fläche berechnet werden. Da sowohl der Bereich (&lt;3,14 um 2) und die mechanische Beanspruchung sehr gering sind, ist die Kraft der mechanischen Stimulation gering. (Beachten Sie, dass, wenn eine Zelle beschädigt ist, die Fluoreszenz tritt aus der Zelle und der Zelle dunkel wird.) </li><li> Messen räumlichen Veränderungen in [Ca 2 +] i nach mechanischer Stimulation mit dem konfokalen Mikroskop. </li><li> Sammeln und Speichern von Bildern. </li><li> Zeichnen einer polygonalen Region von Interesse, um die gesamte Oberfläche der ansprechenden Zellen (aktive Fläche, AA) mit der Software des konfokalen Mikroskops zu definieren. </li></ol>

Autoren haben nichts zu offenbaren.

In diesem Manuskript, beschreiben wir eine einfache Methode, um intrazelluläre Ca 2 +-Wellenausbreitung in Monoschichten von primären bovinen Endothelzellen zu messen, indem sie eine lokalisierte und kontrollierte mechanische Stimulation mit einer Mikropipette. Mechanisch stimulierten Zellen mit einer lokalen Erhöhung der intrazellulären IP 3 und Ca 2 + reagieren, die beide wesentliche intrazelluläre Signalmoleküle, die eine intrazelluläre Ca 2 +-Wellenausbreitung 11,67...

Interzellulären Kommunikation und Signalisierung für die Koordinierung der physiologischen Prozesse in Reaktion auf extrazelluläre Agonisten an das Gewebe und ganzen Organniveau 1,2 erforderlich. Der direkte Weg der interzellulären Kommunikation wird durch das Auftreten von Gap Junctions erstellt. Gap Junctions sind Plaques von Gap Junction Kanälen, die proteinhaltige Kanäle durch den Kopf-an-Kopf-Docking von zwei Connexin (Cx) hemichannels benachbarter Zellen 3,4 (Abbildung 1) ausgebildet sind. Gap Junctions den Durchtritt von kleinen Signal-Moleküle mit einem Molekulargewicht von weniger als 1,5 kDa, darunter Ca 2 + oder IP 3 5, verursacht und Modulieren Ca 2 +-Freisetzung aus intrazellulären Speichern der von den benachbarten Zellen 6 (Abb. 2). Gap Junction Kanäle sind eng durch intra-und intermolekulare Protein-Interaktionen und zelluläre Signalwege reguliert Prozesse wie Redox-Modifikation undPhosphorylierung 7. GJS erleichtern die koordinierte Antwort von verbundenen Zellen, wodurch sie als eine chemische und elektrische Synzytium. Zum Beispiel ist die Verbreitung von Herztätigkeitspotential für die atrialen und ventrikulären Myozyten durch Cx-basierte GJ Kanäle 85 vermittelt. CXS nicht nur eine Rolle als Gap Junction Kanälen, sondern bilden auch ungepaarten hemichannels, wodurch sie als Kanäle in den Membranen ähnlich wie regelmäßige Ionenkanäle 8-10 (Abbildung 1). Hemichannels beteiligen parakrine Signalisierung zwischen benachbarten Zellen durch die Steuerung der Austausch von Ionen und Signalmoleküle zwischen dem intra-und extrazellulären Umgebung. In vielen Zelltypen (zB Epithelzellen, Osteoblasten, Astrocyten, Endothelzellen, etc.) und Organe (wie Gehirn-, Leber-, Retina, Cochlea und dem Gefäßsystem), intrazelluläre Ca 2 +-Wellen für die Koordinierung der vielzelligen Antworten grundlegende <sup&gt; 11. Erhöhungen der intrazellulären Ca 2 +-Spiegel in einer bestimmten Zelle nicht auf diese Zelle beschränkt, sondern Propagation in die umliegenden Nachbarzellen, wodurch eine intrazelluläre Ca 2 +-Welle 12,13. Diese intrazellulären Ca 2 +-Wellen sind für den normalen physiologischen Regulation von Zell-Schichten als Synzytium und deren Fehlregulation hat mit pathophysiologischen Prozessen 11 in Verbindung gebracht wichtig. Im Hornhautendothel und Epithel, studierte verschiedene Gruppen 14-24, 25-33 einschließlich unserer eigenen, die Mechanismen und die Rolle der interzellulären Kommunikation. In nicht-erregbaren Zellen, wie Endothelzellen, treten zwei unterschiedliche Modi der interzellulären Kommunikation 28,29, nämlich interzellulären Gap Junction-Kommunikation und parakrine interzelluläre Kommunikation. Interzellulären Gap Junction-Kommunikation beinhaltet einen direkten Austausch von Signalmolekülen über Gap Junctions 7. Gap junclen interzelluläre Kommunikation ist entscheidend für die Aufrechterhaltung Gewebshomöostase, Controlling Zellproliferation, und zur Errichtung einer synchronisierten Reaktion auf extrazelluläre Stress 10,34,35. In einer Reihe von Krankheiten, ist Gap Junction Kopplung aufgrund defekter CXS reduziert und hierdurch beeinträchtigt interzellulären Gap Junction-Kommunikation 36. Dies unterstreicht die Bedeutung und den Einfluss der interzellulären Gap Junction-Kommunikation in mehrzelligen Organismen. Im Gegensatz zu interzellulären Gap Junction-Kommunikation ist parakrine interzelluläre Kommunikation nicht abhängig von Zell-Zell-Apposition, da es die Freisetzung von diffusible extrazelluläre Botenstoffe (Abbildung 2) beinhaltet. Verschiedene Arten von Signalmolekülen in den extrazellulären Raum durch Signalisierung Zellen freigesetzt wird. Das Molekül wird dann an die Zielzelle, wo es von einem spezifischen Rezeptor Protein nachgewiesen transportiert. Anschließend wird der Rezeptor-Komplex Signal induziert eine zelluläre Antwort, dieBei Entfernung des Signals, Inaktivierung oder Desensibilisierung beendet. Veröffentlicht lipophilen extrazellulären Signalisierung Boten in die Membran eindringen und wirken auf intrazelluläre Rezeptoren. Im Gegensatz dazu hydrophilen Boten nicht über die Plasmamembran der Zelle reagiert, sondern wirken als Liganden, der an der Oberfläche exprimiert Rezeptorproteine, die dann das Relais das Signal an die intrazelluläre Umgebung bindet. Drei große Familien von Zelloberflächen-Rezeptor-Proteine ​​in diesem Prozess zu beteiligen: Ionenkanal-vernetzt, enzyme-linked und G-Protein-gekoppelt. Das freigesetzte Botenstoff kann auf Rezeptoren der gleichen Zelle (autokrine) handeln, auf Zielzellen in unmittelbarer Nähe (parakrine) oder auf entfernten Zielzellen, die das Kreislaufsystem (endokrine) erfordern. In vielen Zelltypen, einschließlich Endothel 28,29 ATP ist eine der wichtigsten hydrophilen, parakrine Faktoren, die die Ausbreitung der interzellulären Ca 2 +-Wellen 37-40 anzutreiben. During mechanische Verformung, Hypoxie, Entzündung oder Stimulation durch verschiedene Mittel, kann ATP von gesunden Zellen in Reaktion auf 41-44 Schubspannung, Stretch oder osmotische Schwellung 44,45 freigegeben werden. Verschiedene ATP-Freisetzung Mechanismen postuliert worden, darunter vesikulären Exozytose 44 und einer Vielzahl von Transport-Mechanismen, wie ATP-binding cassette (ABC) Transporter, plasmalemmalen spannungsabhängigen Anionen-Kanäle 46, P2X7-Rezeptor-Kanäle 47,48, sowie Connexin hemichannels 49-52 und Pannexin hemichannels 43,49,53. Extrazelluläre ATP kann schnell hydrolysiert, ADP, AMP und Adenosin 54,55 durch ectonucleotidases, die in der extrazellulären Umgebung sind. Die extrazellulär freigesetzt ATP und sein Metabolit ADP 56 wird durch Diffusion verbreiten. Die anschließende Wechselwirkung mit dieser Nukleotide Adenosin-Rezeptoren in den benachbarten Zellen in der p verwickeltropagation der interzellulären Ca 2 +-Wellen 28,37,51. Zwei Klassen von Adenosin-Rezeptoren sind: Adenosin ist die wichtigste natürliche Ligand für P1-Purinozeptoren, während sowohl purin (ATP, ADP) und pyrimidin (UTP, UDP) Nucleotide am P2-Purinozeptoren 57 handeln. Interzelluläre Kommunikation kann durch verschiedene Methoden, wie Scrape Loading, Farbstoffübertragung lokalen Uncaging von Agonisten wie IP 3 und Ca 2 +, mechanische Stimulation etc. untersucht werden. Hier beschreiben wir die Studie von Ca 2 +-Wellenausbreitung durch mechanische Stimulation von einer einzigen Zelle ausgelöst. Der Vorteil des Studiums Ca 2 +-Wellenausbreitung durch mechanische Stimulation ist, dass es ein einfaches Werkzeug ermöglicht, um die Ausbreitung des Ca 2 +-Welle im Laufe der Zeit zu quantifizieren und ermöglicht quantitativen Vergleich verschiedener Vorbehandlungen der Zellen. In dem Endothel, diese interzelluläre Ca 2 +-Wellen erlauben coabgestimmte Antwort der Monoschicht, wird als eine mögliche Abwehrmechanismus des nicht regenerativen Hornhautendothel hilft das Endothel der extrazellulären Spannungen während einer intraokularen Operation zu widerstehen, oder unter Einwirkung von Entzündungsmediatoren während Immunabwehr oder Uveitis 58,59.

<table border="1">
<tbody>
 <tr>
 <td>Name of Reagent/Material</td>
 <td>Company</td>
 <td>Catalog Number</td>
 <td>Column1</td>
 </tr>
 <tr>
 <td>Earle's Balanced Salt Solution (EBSS)</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>14155-048</td>
 <td></td>
 </tr>
 <tr>
 <td>Iodine</td>
 <td>Sigma-Aldrich (Deisenhofen, Germany)</td>
 <td>38060-1EA</td>
 <td></td>
 </tr>
 <tr>
 <td>Dulbecco's Modified Eagle's Medium (DMEM)</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>11960-044</td>
 <td></td>
 </tr>
 <tr>
 <td>L-glutamine (Glutamax)</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>35050-038</td>
 <td></td>
 </tr>
 <tr>
 <td>Amphotericin-B</td>
 <td>Sigma-Aldrich (Deisenhofen, Germany)</td>
 <td>A2942</td>
 <td></td>
 </tr>
 <tr>
 <td>Antibiotic-antimycotic mixture</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>15240-096</td>
 <td></td>
 </tr>
 <tr>
 <td>Trypsin</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>25300-054</td>
 <td></td>
 </tr>
 <tr>
 <td>Dulbecco's PBS</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>14190-091</td>
 <td></td>
 </tr>
 <tr>
 <td>Fluo-4 AM</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>F14217</td>
 <td></td>
 </tr>
 <tr>
 <td>ARL-67156 (6-N,N-Diethyl-b,g-dibromomethylene-D-ATP) </td>
 <td>Sigma-Aldrich (Deisenhofen, Germany)</td>
 <td>A265</td>
 <td></td>
 </tr>
 <tr>
 <td>Apyrase VI</td>
 <td>Sigma-Aldrich (Deisenhofen, Germany)</td>
 <td>A6410</td>
 <td></td>
 </tr>
 <tr>
 <td>Apyrase VII</td>
 <td>Sigma-Aldrich (Deisenhofen, Germany)</td>
 <td>A6535</td>
 <td></td>
 </tr>
 <tr>
 <td>Gap26 (VCYDKSFPISHVR)</td>
 <td>Custom peptide synthesis</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>Gap27 (SRPTEKTIFII)</td>
 <td>Custom peptide synthesis</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>Control Peptide (SRGGEKNVFIV)</td>
 <td>Custom peptide synthesis</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>siRNA1 Cx43 (sense: 5'GAAGGAGGAGGAACU-CAAAdTdT) </td>
 <td>Annealed siRNA was purchased at Eurogentec (Luik, Belgium)</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>siRNA2 Cx43 (sense: 5'CAAUUCUUCCUGCCGCAAUdTdT) </td>
 <td>Annealed siRNA was purchased at Eurogentec (Luik, Belgium)</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>siRNA scramble: scrambled sequence of siCx43-1 (sense: 5'GGUAAACG-GAACGAGAAGAdTdT) </td>
 <td>Annealed siRNA was purchased at Eurogentec (Luik, Belgium)</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>TAT-L2 (TAT- DGANVDMHLKQIEIKKFKYGIEEHGK)</td>
 <td>Thermo Electron (Ulm, Germany)</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>TAT-L2-H126K/I130N (TAT-DGANVDMKLKQNEIKKFKYGIEEHGK) </td>
 <td>Thermo Electron (Ulm, Germany)</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td></td>
 <td></td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>Two chambered glass slides</td>
 <td>Laboratory-Tek Nunc (Roskilde, Denmark)</td>
 <td>155380</td>
 <td></td>
 </tr>
 <tr>
 <td>Confocal microscope </td>
 <td>Carl Zeiss Meditec (Jena, Germany)</td>
 <td>LSM510</td>
 <td></td>
 </tr>
 <tr>
 <td>Piezoelectric crystal nanopositioner (Piezo Flexure NanoPositioner)</td>
 <td>PI Polytech (Karlsruhe, Germany)</td>
 <td>P-280</td>
 <td></td>
 </tr>
 <tr>
 <td>HVPZT-amplifier</td>
 <td>PI Polytech (Karlsruhe, Germany)</td>
 <td>E463 HVPZT-amplifier</td>
 <td></td>
 </tr>
 <tr>
 <td>Glass tubes (glass replacement 3.5 nanoliter)</td>
 <td>World Precision Instruments, Inc. Sarasota, Florida, USA</td>
 <td>4878</td>
 <td></td>
 </tr>
 <tr>
 <td>Microelectrode puller </td>
 <td>Zeitz Instrumente (Munchen, Germany)</td>
 <td>WZ DMZ-Universal Puller</td>
 <td></td>
 </tr>
</tbody>
 </table>

mechanical stimulation-induced calcium wave propagation in cell monolayers: the example of bovine corneal endothelial cells

Interzelluläre Kommunikation ist für die Koordinierung der physiologischen Prozesse zwischen Zellen in einer Vielzahl von Organen und Geweben, einschließlich des Gehirns, der Leber, der Retina, Cochlea und Gefäßsystem. In experimentellen Einstellungen interzelluläre Ca 2 +-Wellen kann durch Anlegen einer mechanischen Reiz auf eine einzelne Zelle hervorgerufen werden. Dies führt zur Freisetzung der intrazellulären Signalmoleküle IP 3 und Ca 2 +, die die Ausbreitung des Ca 2 +-Welle einzuleiten konzentrisch von der mechanisch stimuliert Zelle an den benachbarten Zellen. Die wichtigsten molekularen Signalwege, die intrazelluläre Ca 2 +-Wellenausbreitung Kontrolle durch Gap Junction Kanälen durch die direkte Übertragung von IP 3 und hemichannels durch die Freisetzung von ATP zur Verfügung gestellt. Identifizierung und Charakterisierung der Eigenschaften und der Regulierung der unterschiedlichen Connexin und Pannexin Isoformen als Gap Junction Kanälen und hemichannels werden vom quantificatio erlaubtn für die Ausbreitung der interzellulären Ca 2 +-Welle, siRNA, und die Verwendung von Inhibitoren von Gap-junction-Kanäle und hemichannels. Hier beschreiben wir eine Methode, um intrazelluläre Ca 2 +-Welle in Monoschichten von primären Endothelzellen mit Fluo4-AM in Reaktion auf eine kontrollierte und lokalisierte mechanische Reiz durch eine akute, kurz andauernde Verformung der Zelle provoziert geladen messen als Folge Berühren der Zellmembran mit einem Mikromanipulator gesteuert Glas-Mikropipette mit einem Durchmesser der Spitze von weniger als 1 um. Wir beschreiben auch die Isolierung von primären bovinen Endothelzellen und seine Verwendung als Modellsystem, um die Cx43-hemichannel Aktivität wie das angetriebene Kraft für interzelluläre Ca 2 +-Wellen durch die Freisetzung von ATP zu beurteilen. Schließlich diskutieren wir den Einsatz, Vorteile, Grenzen und Alternativen dieser Methode im Rahmen der Gap Junction Kanals und hemichannel Forschung.

Alle Versuche werden unter Einhaltung aller einschlägigen Richtlinien, Vorschriften und Aufsichtsbehörden ausgeführt und das Protokoll die demonstriert wird, unter der Leitung und Genehmigung der Tierpflege und Nutzung Ausschuss der KU Leuven durchgeführt. In Rinder-Endothelzellen (BCEC) werden funktionelle Gap Junctions ausgedrückt und beide interzellulären Gap Junction-Kommunikation und parakrine interzelluläre Kommunikation wesentlich zur interzellulären Kommunikation in einer int...

Watch this Scientific Journal Video about Mechanical Stimulation-induced Calcium Wave Propagation in Cell Monolayers: The Example of Bovine Corneal Endothelial Cells at JoVE.com

Mechanical Stimulation-induced Calcium Wave Propagation in Cell Monolayers: The Example of Bovine Corneal Endothelial Cells

Intercellular Ca<sup&gt; 2 +</sup&gt;-Wellen werden von Gap Junction Kanälen und hemichannels angetrieben. Hier beschreiben wir eine Methode, um interzelluläre Ca messen<sup&gt; 2 +</sup&gt;-Wellen in Zellmonoschichten in Reaktion auf eine lokale Single-Cell-mechanischen Reiz und ihre Anwendung auf die Eigenschaften und Regulation von Gap Junction Kanälen und hemichannels untersuchen.

Mechanische Stimulation induzierte Calcium Wellenausbreitung in Zellmonoschichten: Das Beispiel Bovine Endothelzellen

Intercellular communication is essential for the coordination of physiological processes between cells in a variety of organs and tissues, including the ...

mechanical-stimulation-induced-calcium-wave-propagation-cell

Research

JoVE Journal

Biology

16.1K Aufrufe.  KU Leuven. Intercellular Ca 2 +-Wellen werden von Gap Junction Kanälen und hemichannels angetrieben. Hier beschreiben wir eine Methode, um interzelluläre Ca messen 2 +-Wellen in Zellmonoschichten in Reaktion auf eine lokale Single-Cell-mechanischen Reiz und ihre Anwendung auf die Eigenschaften und Regulation von Gap Junction Kanälen und hemichannels untersuchen.

Serie: Mechanical Stimulation-induced Calcium Wave Propagation in Cell Monolayers: The Example of Bovine Corneal Endothelial Cells

Propagation of Human Embryonic Stem (ES) Cells

Propagation of Human Embryonic Stem ES Cells

Vermehrung von humanen embryonalen Stammzellen (ES-Zellen)

Forschung

Biologie

Isolation and Large Scale Expansion of Adult Human Endothelial Colony Forming Progenitor Cells

This paper introduces a novel recovery strategy for endothelial colony forming progenitor cells (ECFCs) from heparinized but otherwise unmanipulated adult human peripheral blood within a mean of 12 days. After large scale expansion &gt;1x108 ECFCs can be obtained for further tests. Advantageously by using pHPL the contact of human cells with bovine serum antigens can be excluded. By flow cytometry and immunohistochemistry the isolated cells can be characterized as ECFC and their in vitro functionality to form vascular like structures can be tested in a matrigel assay. Further these cells can be subcutaneously injected in a mouse model to form functional, perfused vessels in vivo. After long term expansion and cryopreservation proliferation, function and genomic stability appear to be preserved. 3,4
This animal-protein free isolation and expansion method is easily applicable to generate a large quantity of ECFCs.

Endothelial colony forming progenitor cells (ECFCs) are a promising tool to study vascular homeostasis and repair.1,2 This paper introduces a novel animal-serum free method for isolation and expansion of ECFC from heparinised adult human peripheral blood with pooled human platelet lysate (pHPL) diminishing the risk of anti-bovine immunisation.

Isolation und großräumige Ausdehnung der erwachsenen Menschen Endothelial Colony Forming Progenitorzellen

This paper introduces a novel recovery strategy for endothelial colony forming progenitor cells (ECFCs) from heparinized but otherwise unmanipulated adult ...

Study of the Actin Cytoskeleton in Live Endothelial Cells Expressing GFP-Actin

The microvascular endothelium plays an important role as a selectively permeable barrier to fluids and solutes. The adhesive junctions between endothelial cells regulate permeability of the endothelium, and many studies have indicated the important contribution of the actin cytoskeleton to determining junctional integrity1-5. A cortical actin belt is thought to be important for the maintenance of stable junctions1, 2, 4, 5. In contrast, actin stress fibers are thought to generate centripetal tension within endothelial cells that weakens junctions2-5. Much of this theory has been based on studies in which endothelial cells are treated with inflammatory mediators known to increase endothelial permeability, and then fixing the cells and labeling F-actin for microscopic observation. However, these studies provide a very limited understanding of the role of the actin cytoskeleton because images of fixed cells provide only snapshots in time with no information about the dynamics of actin structures5. 
Live-cell imaging allows incorporation of the dynamic nature of the actin cytoskeleton into the studies of the mechanisms determining endothelial barrier integrity. A major advantage of this method is that the impact of various inflammatory stimuli on actin structures in endothelial cells can be assessed in the same set of living cells before and after treatment, removing potential bias that may occur when observing fixed specimens. Human umbilical vein endothelial cells (HUVEC) are transfected with a GFP-&beta;-actin plasmid and grown to confluence on glass coverslips. Time-lapse images of GFP-actin in confluent HUVEC are captured before and after the addition of inflammatory mediators that elicit time-dependent changes in endothelial barrier integrity. These studies enable visual observation of the fluid sequence of changes in the actin cytoskeleton that contribute to endothelial barrier disruption and restoration. 
Our results consistently show local, actin-rich lamellipodia formation and turnover in endothelial cells. The formation and movement of actin stress fibers can also be observed. An analysis of the frequency of formation and turnover of the local lamellipodia, before and after treatment with inflammatory stimuli can be documented by kymograph analyses. These studies provide important information on the dynamic nature of the actin cytoskeleton in endothelial cells that can used to discover previously unidentified molecular mechanisms important for the maintenance of endothelial barrier integrity.

Microscopic imaging of live endothelial cells expressing GFP-actin allows characterization of dynamic changes in cytoskeletal structures. Unlike techniques that use fixed specimens, this method provides a detailed assessment of temporal changes in the actin cytoskeleton in the same cells before, during, and after various physical, pharmacological, or inflammatory stimuli.

Studie des Aktin-Zytoskeletts in Live Endothelial Cells, die GFP-Aktin

The microvascular endothelium plays an important role as a selectively permeable barrier to fluids and solutes. The adhesive junctions between endothelial ...

Assessment of Calcium Sparks in Intact Skeletal Muscle Fibers

Maintaining homeostatic Ca2+ signaling is a fundamental physiological process in living cells. Ca2+ sparks are the elementary units of Ca2+ signaling in the striated muscle fibers that appear as highly localized Ca2+ release events mediated by ryanodine receptor (RyR) Ca2+ release channels on the sarcoplasmic reticulum (SR) membrane. Proper assessment of muscle Ca2+ sparks could provide information on the intracellular Ca2+&#160;handling properties of healthy and diseased striated muscles. Although Ca2+ sparks events are commonly seen in resting cardiomyocytes, they are rarely observed in resting skeletal muscle fibers; thus there is a need for methods to generate and analyze sparks in skeletal muscle fibers.
Detailed here is an experimental protocol for measuring Ca2+ sparks in isolated flexor digitorm brevis (FDB) muscle fibers using fluorescent Ca2+ indictors and laser scanning confocal microscopy. In this approach, isolated FDB fibers are exposed to transient hypoosmotic stress followed by a return to isotonic physiological solution. Under these conditions, a robust Ca2+ sparks response is detected adjacent to the sarcolemmal membrane in young healthy FDB muscle fibers. Altered Ca2+ sparks response is detected in dystrophic or aged skeletal muscle fibers. This approach has recently demonstrated that membrane-delimited signaling involving cross-talk between inositol (1,4,5)-triphosphate receptor (IP3R) and RyR contributes to Ca2+ spark activation in skeletal muscle. In summary, our studies using osmotic stress induced Ca2+ sparks showed that this intracellular response reflects a muscle signaling mechanism in physiology and aging/disease states, including mouse models of muscle dystrophy (mdx mice) or amyotrophic lateral sclerosis (ALS model).

Described here is a method to directly measure calcium sparks, the elementary units of Ca2+ release from sarcoplasmic reticulum&#160;in intact skeletal muscle fibers. This method utilizes osmotic-stress-mediated triggering of Ca2+ release from ryanodine receptor in isolated muscle fibers. The dynamics and homeostatic capacity of intracellular Ca2+ signaling can be employed to assess muscle function in health and disease.

Bewertung von Calcium in Sparks Intact Skelettmuskelfasern

Maintaining homeostatic Ca2+ signaling is a fundamental physiological process in living cells. Ca2+ sparks are the elementary units of Ca2+ signaling in ...

Endothelial Cell Tube Formation Assay for the In Vitro Study of Angiogenesis

Angiogenesis is a vital process for normal tissue development and wound healing, but is also associated with a variety of pathological conditions. Using this protocol, angiogenesis may be measured in vitro in a fast, quantifiable manner. Primary or immortalized endothelial cells are mixed with conditioned media and plated on basement membrane matrix. The endothelial cells form capillary like structures in response to angiogenic signals found in conditioned media. The tube formation occurs quickly with endothelial cells beginning to align themselves within 1&#160;hr and lumen-containing tubules beginning to appear within 2 hr. Tubes can be visualized using a phase contrast inverted microscope, or the cells can be treated with calcein AM prior to the assay and tubes visualized through fluorescence or confocal microscopy. The number of branch sites/nodes, loops/meshes, or number or length of tubes formed can be easily quantified as a measure of in vitro angiogenesis. In summary, this assay can be used to identify genes and pathways that are involved in the promotion or inhibition of angiogenesis in a rapid, reproducible, and quantitative manner.

Endothelial Cell Tube Formation Assay for the In Vitro Study of Angiogenesis

The tube formation assay is a fast, quantifiable method for measuring in vitro angiogenesis. Endothelial cells are combined with conditioned media and plated on basement membrane extract. Tube formation occurs within hours and newly formed tubules easily quantified.

Endothelzellen Schlauchbildung Assay für die<em&gt; In-vitro-</em&gt; Studium der Angiogenese

Angiogenesis is a vital process for normal tissue development and wound healing, but is also associated with a variety of pathological conditions. Using ...

Measuring the Osmotic Water Permeability Coefficient (Pf) of Spherical Cells: Isolated Plant Protoplasts as an Example

Studying AQP regulation mechanisms is crucial for the understanding of water relations at both the cellular and the whole plant levels. Presented here is a simple and very efficient method for the determination of the osmotic water permeability coefficient (Pf) in plant protoplasts, applicable in principle also to other spherical cells such as frog oocytes. The first step of the assay is the isolation of protoplasts from the plant tissue of interest by enzymatic digestion into a chamber with an appropriate isotonic solution. The second step consists of an osmotic challenge assay: protoplasts immobilized on the bottom of the chamber are submitted to a constant perfusion starting with an isotonic solution and followed by a hypotonic solution. The cell swelling is video recorded. In the third step, the images are processed offline to yield volume changes, and the time course of the volume changes is correlated with the time course of the change in osmolarity of the chamber perfusion medium, using a curve fitting procedure written in Matlab (the &#8216;PfFit&#8217;), to yield Pf.

Measuring the Osmotic Water Permeability Coefficient Pf of Spherical Cells: Isolated Plant Protoplasts as an Example

Measuring the osmotic water permeability coefficient (Pf) of cells can help understand the regulatory mechanisms of aquaporins (AQPs). Pf determination in spherical plant cell protoplasts presented here involves protoplasts isolation and numerical analysis of their initial rate of volume change as a result of an osmotic challenge during constant bath perfusion.

Messung des osmotischen Wasserdurchlässigkeit Koeffizient (P<sub&gt; F</sub&gt;) Von sphärischen Zellen: Isolierte Pflanzenprotoplasten als Beispiel

Studying AQP regulation mechanisms is crucial for the understanding of water relations at both the cellular and the whole plant levels. Presented here is ...

Isolation of Murine Valve Endothelial Cells

Normal valve structures consist of stratified layers of specialized extracellular matrix (ECM) interspersed with valve interstitial cells (VICs) and surrounded by a monolayer of valve endothelial cells (VECs). VECs play essential roles in establishing the valve structures during embryonic development, and are important for maintaining life-long valve integrity and function. In contrast to a continuous endothelium over the surface of healthy valve leaflets, VEC disruption is commonly observed in malfunctioning valves and is associated with pathological processes that promote valve disease and dysfunction. Despite the clinical relevance, focused studies determining the contribution of VECs to development and disease processes are limited. The isolation of VECs from animal models would allow for cell-specific experimentation. VECs have been isolated from large animal adult models but due to their small population size, fragileness, and lack of specific markers, no reports of VEC isolations in embryos or adult small animal models have been reported. Here we describe a novel method that allows for the direct isolation of VECs from mice at embryonic and adult stages. Utilizing the Tie2-GFP reporter model that labels all endothelial cells with Green Fluorescent Protein (GFP), we have been successful in isolating GFP-positive (and negative) cells from the semilunar and atrioventricular valve regions using fluorescence activated cell sorting (FACS). Isolated GFP-positive VECs are enriched for endothelial markers, including CD31 and von Willebrand Factor (vWF), and retain endothelial cell expression when cultured; while, GFP-negative cells exhibit molecular profiles and cell shapes consistent with VIC phenotypes. The ability to isolate embryonic and adult murine VECs allows for previously unattainable molecular and functional studies to be carried out on a specific valve cell population, which will greatly improve our understanding of valve development and disease mechanisms.

The ability to isolate heart valve endothelial cells (VECs) is critical for understanding mechanisms of valve development, maintenance, and disease. Here we describe the isolation of VECs from embryonic and adult Tie2-GFP mice using FACS that will allow for studies determining the contribution of VECs in developmental and disease processes.

Isolierung von murinen Ventil Endothelzellen

Normal valve structures consist of stratified layers of specialized extracellular matrix (ECM) interspersed with valve interstitial cells (VICs) and ...

Quantitation of Endothelial Cell Adhesiveness In Vitro

One of the cardinal processes of inflammation is the infiltration of immune cells from the lumen of the blood vessel to the surrounding tissue. This occurs when endothelial cells, which line blood vessels, become adhesive to circulating immune cells such as monocytes. In vitro measurement of this adhesiveness has until now been done by quantifying the total number of monocytes that adhere to an endothelial layer either as a direct count or by indirect measurement of the fluorescence of adherent monocytes. While such measurements do indicate the average adhesiveness of the endothelial cell population, they are confounded by a number of factors, such as cell number, and do not reveal the proportion of endothelial cells that are actually adhesive. Here we describe and demonstrate a method which allows the enumeration of adhesive cells within a tested population of endothelial monolayer. Endothelial cells are grown on glass coverslips and following desired treatment are challenged with monocytes (that may be fluorescently labeled). After incubation, a rinsing procedure, involving multiple rounds of immersion and draining, the cells are fixed. Adhesive endothelial cells, which are surrounded by monocytes are readily identified and enumerated, giving an adhesion index that reveals the actual proportion of endothelial cells within the population that are adhesive.

Quantitation of Endothelial Cell Adhesiveness In Vitro

We report an in vitro method that allows the quantitation of the actual number of adhesive cells within an endothelial cell monolayer.

Die Quantifizierung der Endothelial Cell Haftfähigkeit<em&gt; In-vitro-</em

One of the cardinal processes of inflammation is the infiltration of immune cells from the lumen of the blood vessel to the surrounding tissue. This ...

High-resolution Time-lapse Imaging and Automated Analysis of Microtubule Dynamics in Living Human Umbilical Vein Endothelial Cells

The physiological process by which new vasculature forms from existing vasculature requires specific signaling events that trigger morphological changes within individual endothelial cells (ECs). These processes are critical for homeostatic maintenance such as wound healing, and are also crucial in promoting tumor growth and metastasis. EC morphology is defined by the organization of the cytoskeleton, a tightly regulated system of actin and microtubule (MT) dynamics that is known to control EC branching, polarity and directional migration, essential components of angiogenesis. To study MT dynamics, we used high-resolution fluorescence microscopy coupled with computational image analysis of fluorescently-labeled MT plus-ends to investigate MT growth dynamics and the regulation of EC branching morphology and directional migration. Time-lapse imaging of living Human Umbilical Vein Endothelial Cells (HUVECs) was performed following transfection with fluorescently-labeled MT End Binding protein 3 (EB3) and Mitotic Centromere Associated Kinesin (MCAK)-specific cDNA constructs to evaluate effects on MT dynamics. PlusTipTracker software was used to track EB3-labeled MT plus ends in order to measure MT growth speeds and MT growth lifetimes in time-lapse images. This methodology allows for the study of MT dynamics and the identification of how localized regulation of MT dynamics within sub-cellular regions contributes to the angiogenic processes of EC branching and migration.

Protocols for Human Umbilical Vein Endothelial Cell (HUVEC) culture, transient transfection of fluorescently-labeled markers of microtubule growth, live-cell imaging and automated analysis of interphase microtubule growth dynamics are detailed.

Hochauflösende Zeitraffer-Imaging und automatische Analyse von Dynamik der Mikrotubuli in lebenden menschlichen Endothelzellen aus der Nabelvene

The physiological process by which new vasculature forms from existing vasculature requires specific signaling events that trigger morphological changes ...

A Graphical User Interface for Software-assisted Tracking of Protein Concentration in Dynamic Cellular Protrusions

Filopodia are dynamic, finger-like cellular protrusions associated with migration and cell-cell communication. In order to better understand the complex signaling mechanisms underlying filopodial initiation, elongation and subsequent stabilization or retraction, it is crucial to determine the spatio-temporal protein activity in these dynamic structures. To analyze protein function in filopodia, we recently developed a semi-automated tracking algorithm that adapts to filopodial shape-changes, thus allowing parallel analysis of protrusion dynamics and relative protein concentration along the whole filopodial length. Here, we present a detailed step-by-step protocol for optimized cell handling, image acquisition and software analysis. We further provide instructions for the use of optional features during image analysis and data representation, as well as troubleshooting guidelines for all critical steps along the way. Finally, we also include a comparison of the described image analysis software with other programs available for filopodia quantification. Together, the presented protocol provides a framework for accurate analysis of protein dynamics in filopodial protrusions using image analysis software.

We present a software solution for semi-automated tracking of relative protein concentration along the length of dynamic cellular protrusions.

Eine grafische Benutzeroberfläche für die softwaregestützte Verfolgung der Proteinkonzentration in dynamischen zellulären Vorsprüngen

Filopodia are dynamic, finger-like cellular protrusions associated with migration and cell-cell communication. In order to better understand the complex ...