The authors would like to acknowledge Natalie Doude and David Westerway (University of Alberta) for providing us Sho cDNA, Christophe Chevalier (INRA) for plasmid construction, Michel Br&#233;mont (INRA) for providing us BL21Sol bacteria; Christine Longin (INRA) for TEM assistance and Edith Pajot-Augy (INRA) for comments and proofreading.

1. Generación de plásmido y Shadoo Expresión Nota: La proteína murina Shadoo gen que codifica (Shadoo 25 a 122), se subclonó en el vector de expresión pET-28 11. Este clon se transformó en E. SoluBL21 coli cepa bacteriana, para expresar la proteína Shadoo con una etiqueta de hexahistidina N-terminal, (HHHHHHHHHHSSGHIDDDDKHMKGGRGGARGSARGVRGGARGASRVRVRP APRYGSSLRVAAAGAAAGAAAGVAAGLATGSGWRRTSGPGELGLEDDENGAMGGNGTDRGVYSYWAWTSG) como se explicó previamente 11. El plásmido se puede solicitar a los autores. El peso molecular de Shadoo calculado a partir de su secuencia de aminoácidos es 12,243.2 Da. Nota: Realice todas las manipulaciones con bacterias bajo una campana de flujo laminal o cerca de Bunsen llama. <ol><li> Transformar bacterias SoluBL21 competentes con el 28-Su plásmido pET -Shadoo 6, utilizando un protocolo de choque térmico estándar. Para esta mezcla 1 a 5 l de la plásmido (típicamente 10 a 100 pgng) en 50 l de las bacterias en un tubo. Realice el choque térmico a 42 ° C durante 45 segundos. </li><li> Cultura bacterias transformadas a 37 ° C hasta 600 A de 0,5 a 0,7 en un medio Luria-Bertani suplementado con 40 mg / ml de kanamicina (Figura 1B). </li><li> Inducir Shadoo expresión O / N mediante la adición de 240 mg / ml de isopropil-β-D-tiogalactopiranósido, ITPG, a la cultura. Cultura de las bacterias bajo agitación a 150 rpm a 37 ° C. Nota: Por lo general, la cultura bacteriana alcanza un 600 de 3 O / N. Nota: Transformado bacterias pueden ser almacenadas a -80 ° C para la futura producción de proteínas. Para ello, agregue el 10% -50% (v / v) de glicerol estéril en alícuotas de cultivo bacteriano y congelar a -80 ° C. </li></ol><img alt="Figura 1" src="/files/ftp_upload/53432/53432fig1.jpg" /> Figura 1. Esquema de Shadoo construcción de expresión, las bacterias transformación y la inducción de la expresión Shadoo (como se describe en el paso 1). </strong&gt; (A) El constructo de expresión para Shadoo codifica una etiqueta de hexahistidina fusionado al extremo N-terminal de la proteína, Nt. El esquema muestra que la proteína Shadoo contiene repeticiones básicos arginina / glicina (cilindro verde), un dominio hidrófobo (HD), y un único sitio de N-glicosilación (CHO), seguido de un terminal C (Ct). (B) pET-28-Su 6 -Shadoo plásmido se transforma en bacterias SoluBL21 por choque térmico de 45 segundos a 42 ° C. Bacterias transformadas se sembraron en agar selectivo que contenía 40 mg / ml de kanamicina. Una sola colonia de la placa se utiliza para inocular un cultivo en un matraz de agitador de 1.000-3.000 ml. La expresión de la proteína recombinante se indujo con IPTG 1 mM. <a href="https://www.jove.com/files/ftp_upload/53432/53432fig1highres.jpg" target="_blank">Por favor haga clic aquí para ver una versión más grande de esta figura.</a> 2. Purificación de Shadoo proteínas por baja presión cromatografía líquida (LPLC) <ol><li> La lisis celular e Inconclusión preparación cuerpos <ol><li> Recoger la suspensión bacteriana y la transfiere en tubos de centrifugación (Figura 2). </li><li> Giran a 2500 xg, durante 20 min a 4 ° C. Eliminar el sobrenadante por decantación y pellets de resuspender en 15 ml de tampón (Tris 50 mM, EDTA 10 mM, pH 8 con cóctel anti-proteasa) para cada pellet derivado de 500 ml de cultivo celular. Nota: Las bolitas resuspendidas pueden ser congelados y almacenados a -20 ° C durante varios días. La congelación facilita la lisis de células bacterianas. </li><li> Compruebe la sobre-expresión de la proteína recombinante utilizando bacterias crudo gránulos mediante análisis de SDS-PAGE y tinción de Coomassie. <ol><li> Para ello, de centrífuga de 1 ml de cultivo bacteriano para sedimentar las células. Añadir 100 l solución de Laemmli de desnaturalización (mM Tris-HCl 277,8, pH 6,8, 4,4% de SDS, 44,4% w / v de glicerol, 0,02% azul de bromofenol) para sedimentar y se calienta a 100 ° C durante 5 min. </li><li> Cargar 10 l de la muestra a un gel de acrilamida al 12%, ejecute SDS-PAGE y visualize separa proteínas por tinción de Coomassie. </li></ol></li><li> Añadir Triton X-100 hasta una concentración final 0,5% al ​​sedimento resuspendido completamente a partir de 2.1.2). </li><li> Se incuba la suspensión en baño de agua a 37 ° C durante 30 min. </li><li> Sonicar la suspensión durante 5 min a 6-12 micras amplitud pico a pico en agua enfriada con hielo para lisar células bacterianas. </li><li> Transferencia sonicó la suspensión en 50 ml tubos de centrifugación limpio. </li><li> Tubos centrífuga a 15.000 xg durante 15 min a 4 ° C. </li><li> Eliminar el sobrenadante por decantación y añadir 5 ml de tampón de unión (20 mM de tampón Tris-HCl, pH 7,4, NaCl 0,5 M, 8 M urea, 5 mM imidazol) por tubo. </li><li> Colocar los tubos en la rotación de la rueda O / N para volver a suspender por completo las proteínas a partir de cuerpos de inclusión. </li></ol><img alt="Figura 2" src="/files/ftp_upload/53432/53432fig2.jpg" /> Figura 2. Esquema de purificación de inclusióncuerpos (como se describe en el paso 2.1). transformadas bacterias que expresan Shadoo se recogen por centrifugación y se resuspendieron en el tampón de lisis. La suspensión se incubó a 37 ° C durante 30 min, y luego se sometió a ultrasonidos para romper mecánicamente las células bacterianas. La sonicación se lleva a cabo en hielo para evitar el calentamiento de la muestra. Células rotas se recogieron por centrifugación y se resuspendieron en un tampón que contiene urea 8 M para solubilizar proteínas a partir de cuerpos de inclusión. <a href="https://www.jove.com/files/ftp_upload/53432/53432fig2highres.jpg" target="_blank">Por favor haga clic aquí para ver una versión más grande de esta figura.</a> </li><li> Cromatografía de Ni 2+ -affinity Nota: La cromatografía se realiza en un sistema de FPLC usando Ni2 + -charged, columna quelante de 5 ml de Sepharose (Figura 3A). Todas las soluciones se cargan en la columna con un caudal de 1 ml / min. <ol><li> Inyectar 10 ml de solución 4 agua 0,2 M NiSO _ en la columna de Sepharose con el fin de cargarlacon iones de Ni 2+. </li><li> Equilibrar la columna cargada con Ni 2+ iones mediante la inyección de un 30-50 ml de tampón de unión que contiene la una baja concentración de imidazol (20 mM de tampón Tris-HCl, pH 7,4, NaCl 0,5 M, 8 M urea, 5 mM imidazol). </li><li> Cargar las proteínas de urea-solubilizado con un bucle de inyección de 50 ml. </li><li> Recuperar la fracción de flujo a través lavando a fondo la columna con tampón de 10 ml bajo imidazol de unión (20 mM de tampón Tris-HCl, pH 7,4, NaCl 0,5 M, 8 M urea, 5 mM imidazol) con el fin de eliminar un máximo de proteínas no unidas de la columna. </li><li> Lavar la columna con 50-100 ml de tampón de lavado (20 mM Tris-HCl, pH 7,4, NaCl 0,5 M, 8 M urea, 80 mM imidazol) para eluir las proteínas unidas de forma no específica a la columna. </li><li> Aplicar un gradiente lineal 15 min de 80 a 800 mM imidazol en el tampón que contiene 20 mM Tris-HCl, pH 7,4, NaCl 0,5 M, 8 M urea. Recoger fracciones de 1 ml durante la aplicación del gradiente. Nota: Las proteínas etiquetadas-Su se eluyen ingeniogradiente ha de tampón que contiene imidazol (usado como competidor). </li><li> Tomar una alícuota de 8 l de cada fracción y añadir 4 l solución de desnaturalización 4x Laemmli (ver 2.1.3.1). Soluciones de calor a 100 ° C durante 5 min. </li><li> Cargar 10 l de tamaño proteína marcadora y 10 l de cada muestra en el gel de acrilamida al 12%, correr SDS-PAGE y visualizar proteínas separadas por tinción de Coomassie. Nota: El peso molecular calculado de Shadoo formar su secuencia de aminoácidos es 12,243.2 Da. </li><li> Piscina todas las fracciones que contienen Shadoo. </li></ol><img alt="figura 3" src="/files/ftp_upload/53432/53432fig3.jpg" /> Figura 3. procedimiento de purificación (tal como se describe en los pasos 2.2-2.4). (A) Ni 2+ iones pueden ser coordinados por los residuos de histidina, lo que permite la purificación selectiva de proteínas polihistidina-etiquetado. El imidazol se utiliza para eluir la proteína, a través desu capacidad de coordinar con el 2+ -ion Ni y desplazar la proteína unida. (B) Las proteínas de diferente radio hidrodinámico que fueron retenidos en el Ni2 + -columna están separados en una columna de exclusión de tamaño. Las proteínas se eluyen de la más grande a los más pequeños. (C) Antes de su uso, las fracciones que contenían Shadoo se reúnen y se desalaron para eliminar la urea, imidazol y sales. Ensayos de control de calidad incluyen SDS-PAGE / tinción Coomassie, Western Blot. Purificada Shadoo puede ser liofilizado. Liofilizado Shadoo es estable durante meses cuando se almacena a -20 ° C. <a href="https://www.jove.com/files/ftp_upload/53432/53432fig3highres.jpg" target="_blank">Por favor haga clic aquí para ver una versión más grande de esta figura.</a> </li><li> Cromatografía de exclusión por tamaño Nota: Una segunda etapa de purificación consiste en la cromatografía de exclusión por tamaño que separa la proteína Shadoo de las otras proteínas co-eluidos durante la primera etapa de purificación(Figura 3B). <ol><li> Equilibrar la columna Superdex de 120 ml de volumen total del lecho mediante la inyección de 250 ml de 20 mM de tampón Tris-HCl, pH 7,4, NaCl 0,5 M, 8 M urea en la velocidad de flujo de 1,5 ml / min. </li><li> Cargar fracciones reunidas que contienen Shadoo de 2.2.9 en la columna equilibrada. Recoger fracciones de 1 ml después de la volumen vacío de la columna de 40 ml sobre el flujo constante del tampón anterior. </li><li> Tomar una alícuota de 10 l de cada fracción y le realizará un análisis de SDS-PAGE y tinción con Coomassie como se describió anteriormente para saber qué contienen fracciones Shadoo. </li><li> Fracciones que contienen Shadoo piscina. </li></ol></li><li> Desalación Nota: procedimiento de desalación elimina sales, imidazol y urea para obtener la proteína recombinante Shadoo en un tampón adecuado para posteriores estudios biofísicos y bioquímicos (Figura 3C). El mismo resultado se puede obtener muestras de diálisis contra el tampón. <ol><li> Equilibrar una columna de desalación de 53 ml con 150 mlde 10 mM de tampón de acetato de amonio, pH 5, a un caudal de 5 ml / min. </li><li> Cargar agruparon fracciones Shadoo en la columna. Tras la inyección del tampón de acetato de amonio recoger manualmente fracciones que muestran un aumento de la señal a 280 nm en la salida del detector de UV. </li><li> Liofilizar la Shadoo desalada y almacenarla a -20 ° C. </li><li> Disolver Shadoo liofilizado en un tampón adecuado, mM tampón tal como acetato de sodio 10, pH 5, antes de su uso. Nota: La etiqueta de polihistidina se puede eliminar con enteroquinasa. </li></ol></li></ol> 3. En Vitro Montaje de Shadoo en amiloide fibrillas en Physiological pH Nota: Los agregados de proteínas Shadoo y espontáneamente forman fibrillas a pH ≥ 7 11. <img alt="Figura 4" src="/files/ftp_upload/53432/53432fig4.jpg" /> Figura 4. Esquema de Shadoo replegamiento a las fibrillas de amiloide (como se descricama en el paso 3). purificada Shadoo convierte espontáneamente a las fibrillas de amiloide cuando se disuelve en tampón de pH ≥ 7. En una solución ácida, Shadoo convierte a las fibrillas de amiloide tras la incubación con M Gdn-HCl 1 mientras se agitaba. Ensayos de control de calidad incluyen la microscopía electrónica y tinción ThT. <a href="https://www.jove.com/files/ftp_upload/53432/53432fig4highres.jpg" target="_blank">Por favor haga clic aquí para ver una versión más grande de esta figura.</a> <ol><li> Diluir Shadoo a una concentración final de 2 mM en un tampón mM Tris-HCl 20, pH 7,4. Medir la concentración midiendo la densidad óptica de la solución a 280 nm y usando el coeficiente de extinción deducida a partir de la composición de aminoácidos Shadoo de 20.970. </li><li> Incubar 500 l de la solución en un tubo de plástico cónico a 4 ° C durante un par de semanas, para permitir la conversión espontánea de proteínas a las estructuras amiloides (Figura 4). </li><li> Agregar recién preparada tioflavina T (ThT) a un conce definitivantration de 10 micras a una alícuota de 100 l de la solución Shadoo. Incubar la solución durante 5 min a RT. Medida de emisión de fluorescencia 460-520 nm usando una longitud de onda de excitación de 435 nm para verificar la presencia de estructuras amiloides 17. </li></ol> 4. En Vitro Montaje de Shadoo de amiloide fibrillas en ácida pH <ol><li> Diluir Shadoo en 1 M GdnHCl, 20 mM de tampón Na-acetato, pH 5 a una concentración final de 2 mM. </li><li> Incubar 500 l de esta solución en un tubo cónico con agitación continua a 37 ° C, durante 3-7 días. </li><li> Compruebe la presencia de fibrillas amiloides añadiendo ThT a una alícuota de la solución como en 3.3. </li><li> Dializar suspensión obtenida contra 10 mM de tampón Na-acetato, pH 5,0, para purificar las fibrillas de amiloide Shadoo. </li><li> Guarde fibrillas purificados a 4 ° C. </li></ol><img alt="Figura 5" src="/files/ftp_upload/53432/53432fig5.jpg"/&gt; Figura 5. Los resultados representativos. Las fracciones proteicas eluidas de Ni 2+ -charged columna quelante de (A) y la columna de exclusión por tamaño (B) se analizaron mediante SDS-PAGE y tinción de Coomassie. Identificación de Shadoo purificado se evaluó a través de anticuerpo anti-Shadoo SPRN (C). <a href="https://www.jove.com/files/ftp_upload/53432/53432fig5large.jpg" target="_blank">Por favor, haga clic aquí para ver una versión más grande de esta figura.</a>

<ol><li>Biasini, E., Turnbaugh, J. A., Unterberger, U., Harris, D. A. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((Prion+protein+at+the+crossroads+of+physiology+and+disease%5BTitle%5D)+AND+%22Trends+in+Neurosciences%22%5BJournal%5D)">Prion protein at the crossroads of physiology and disease.</a> Trends in Neurosciences. 35, 92-103 (2012).</li>
<li>Colby, D. W., Prusiner, S. B. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((De+novo+generation+of+prion+strains%5BTitle%5D)+AND+%22Nature+Reviews.+Microbiology%22%5BJournal%5D)">De novo generation of prion strains.</a> Nature Reviews. Microbiology. 9, 771-777 (2011).</li>
<li>Chiti, F., Dobson, C. M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((Protein+misfolding%2C+functional+amyloid%2C+and+human+disease%5BTitle%5D)+AND+%22Annual+Review+of+Biochemistry%22%5BJournal%5D)">Protein misfolding, functional amyloid, and human disease.</a> Annual Review of Biochemistry. 75, 333-366 (2006).</li>
<li>Nelson, R., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((Structure+of+the+cross-beta+spine+of+amyloid-like+fibrils%5BTitle%5D)+AND+%22Nature%22%5BJournal%5D)">Structure of the cross-beta spine of amyloid-like fibrils.</a> Nature. 435, 773-778 (2005).</li>
<li>Murphy, R. M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((Kinetics+of+amyloid+formation+and+membrane+interaction+with+amyloidogenic+proteins%5BTitle%5D)+AND+%22Biochimica+et+Biophysica+Acta%22%5BJournal%5D)">Kinetics of amyloid formation and membrane interaction with amyloidogenic proteins.</a> Biochimica et Biophysica Acta. 1768, 1923-1934 (2007).</li>
<li>Steunou, S., Chich, J. F., Rezaei, H., Vidic, J. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((Biosensing+of+lipid-prion+interactions%3A+insights+on+charge+effect%2C+Cu%28II%29-ions+binding+and+prion+oligomerization%5BTitle%5D)+AND+%22Biosensors+%26+Bioelectronics%22%5BJournal%5D)">Biosensing of lipid-prion interactions: insights on charge effect, Cu(II)-ions binding and prion oligomerization.</a> Biosensors & Bioelectronics. 26, 1399-1406 (2010).</li>
<li>Watts, J. C., Westaway, D. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((The+prion+protein+family%3A+diversity%2C+rivalry%2C+and+dysfunction%5BTitle%5D)+AND+%22Biochimica+et+Biophysica+Acta%22%5BJournal%5D)">The prion protein family: diversity, rivalry, and dysfunction.</a> Biochimica et Biophysica Acta. 1772, 654-672 (2007).</li>
<li>Westaway, D., Daude, N., Wohlgemuth, S., Harrison, P. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((The+PrP-like+proteins+Shadoo+and+Doppel%5BTitle%5D)+AND+%22Topics+in+Current+Chemistry%22%5BJournal%5D)">The PrP-like proteins Shadoo and Doppel.</a> Topics in Current Chemistry. 305, 225-256 (2011).</li>
<li>Baillod, P., Garrec, J., Tavernelli, I., Rothlisberger, U. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((Prion+versus+doppel+protein+misfolding%3A+new+insights+from+replica-exchange+molecular+dynamics+simulations%5BTitle%5D)+AND+%22Biochemistry%22%5BJournal%5D)">Prion versus doppel protein misfolding: new insights from replica-exchange molecular dynamics simulations.</a> Biochemistry. 52, 8518-8526 (2013).</li>
<li>Daude, N., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((Wild-type+Shadoo+proteins+convert+to+amyloid-like+forms+under+native+conditions%5BTitle%5D)+AND+%22Journal+of+Neurochemistry%22%5BJournal%5D)">Wild-type Shadoo proteins convert to amyloid-like forms under native conditions.</a> Journal of Neurochemistry. 113, 92-104 (2010).</li>
<li>Li, Q., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((Shadoo+binds+lipid+membranes+and+undergoes+aggregation+and+fibrillization%5BTitle%5D)+AND+%22Biochemical+and+Biophysical+Research+Communications%22%5BJournal%5D)">Shadoo binds lipid membranes and undergoes aggregation and fibrillization.</a> Biochemical and Biophysical Research Communications. 438, 519-525 (2013).</li>
<li>Watts, J. C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((The+CNS+glycoprotein+Shadoo+has+PrP%28C%29-like+protective+properties+and+displays+reduced+levels+in+prion+infections%5BTitle%5D)+AND+%22The+EMBO+Journal%22%5BJournal%5D)">The CNS glycoprotein Shadoo has PrP(C)-like protective properties and displays reduced levels in prion infections.</a> The EMBO Journal. 26, 4038-4050 (2007).</li>
<li>Watts, J. C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((Protease-resistant+prions+selectively+decrease+Shadoo+protein%5BTitle%5D)+AND+%22PLoS+Pathogens%22%5BJournal%5D)">Protease-resistant prions selectively decrease Shadoo protein.</a> PLoS Pathogens. 7, e1002382(2011).</li>
<li>Westaway, D., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((Down-regulation+of+Shadoo+in+prion+infections+traces+a+pre-clinical+event+inversely+related+to+PrP%28Sc%29+accumulation%5BTitle%5D)+AND+%22PLoS+Pathogens%22%5BJournal%5D)">Down-regulation of Shadoo in prion infections traces a pre-clinical event inversely related to PrP(Sc) accumulation.</a> PLoS Pathogens. 7, e1002391(2011).</li>
<li>Chevalier, C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((PB1-F2+influenza+A+virus+protein+adopts+a+beta-sheet+conformation+and+forms+amyloid+fibers+in+membrane+environments%5BTitle%5D)+AND+%22The+Journal+of+Biological+Chemistry%22%5BJournal%5D)">PB1-F2 influenza A virus protein adopts a beta-sheet conformation and forms amyloid fibers in membrane environments.</a> The Journal of Biological Chemistry. 285, 13233-13243 (2010).</li>
<li>Tarus, B., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((Oligomerization+paths+of+the+nucleoprotein+of+influenza+A+virus%5BTitle%5D)+AND+%22Biochimie%22%5BJournal%5D)">Oligomerization paths of the nucleoprotein of influenza A virus.</a> Biochimie. 94, 776-785 (2012).</li>
<li>Biancalana, M., Koide, S. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((Molecular+mechanism+of+Thioflavin-T+binding+to+amyloid+fibrils%5BTitle%5D)+AND+%22Biochimica+et+Biophysica+Acta%22%5BJournal%5D)">Molecular mechanism of Thioflavin-T binding to amyloid fibrils.</a> Biochimica et Biophysica Acta. 1804, 1405-1412 (2010).</li>
<li>Minic, J., Sautel, M., Salesse, R., Pajot-Augy, E. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((Yeast+system+as+a+screening+tool+for+pharmacological+assessment+of+g+protein+coupled+receptors%5BTitle%5D)+AND+%22Current+Medicinal+Chemistry%22%5BJournal%5D)">Yeast system as a screening tool for pharmacological assessment of g protein coupled receptors.</a> Current Medicinal Chemistry. 12, 961-969 (2005).</li>
<li>Schein, C. H. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((A+cool+way+to+make+proteins%5BTitle%5D)+AND+%22Nature+Biotechnology%22%5BJournal%5D)">A cool way to make proteins.</a> Nature Biotechnology. 22, 826-827 (2004).</li>
<li>Sorensen, H. P., Mortensen, K. K. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((Advanced+genetic+strategies+for+recombinant+protein+expression+in+Escherichia+coli%5BTitle%5D)+AND+%22Journal+of+Biotechnology%22%5BJournal%5D)">Advanced genetic strategies for recombinant protein expression in Escherichia coli.</a> Journal of Biotechnology. 115, 113-128 (2005).</li>
<li>Zhang, J., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((Disruption+of+glycosylation+enhances+ubiquitin-mediated+proteasomal+degradation+of+Shadoo+in+Scrapie-infected+rodents+and+cultured+cells%5BTitle%5D)+AND+%22Molecular+Neurobiology%22%5BJournal%5D)">Disruption of glycosylation enhances ubiquitin-mediated proteasomal degradation of Shadoo in Scrapie-infected rodents and cultured cells.</a> Molecular Neurobiology. 49, 1373-1384 (2014).</li>
<li>Englund, P. T. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((The+structure+and+biosynthesis+of+glycosyl+phosphatidylinositol+protein+anchors%5BTitle%5D)+AND+%22Annual+Review+of+Biochemistry%22%5BJournal%5D)">The structure and biosynthesis of glycosyl phosphatidylinositol protein anchors.</a> Annual Review of Biochemistry. 62, 121-138 (1993).</li>
<li>Puig, B., Altmeppen, H., Glatzel, M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((The+GPI-anchoring+of+PrP%3A+implications+in+sorting+and+pathogenesis%5BTitle%5D)+AND+%22Prion%22%5BJournal%5D)">The GPI-anchoring of PrP: implications in sorting and pathogenesis.</a> Prion. 8, 11-18 (2014).</li>
</ol>

The authors have nothing to disclose.

Se presenta un protocolo fácil y eficiente tanto para la expresión y purificación de una gran cantidad de proteína Shadoo recombinante de ratón. El método descrito permite la solubilización y purificación de (Su 6) proteína recombinante Shadoo-etiquetados éxito. Es importante, como se ha señalado en el título, que cuando se expresa en una bacteria procariota E. coli Shadoo se acumula en cuerpos de inclusión. Antes de la purificación Shadoo, las bacterias tienen que ser lisadas por sonic...

Enfermedades neurodegenerativas causadas por priones, que incluyen la encefalopatía espongiforme bovina en el ganado, la tembladera en las ovejas y la enfermedad de Creutzfeldt-Jakob en humanos, son fatales e incurable. Las enfermedades priónicas se caracterizan por cambios conformacionales de la proteína priónica celular compuestos principalmente de alfa-hélices, en el β-hoja de cruz enriquecido amiloide confórmero 1,2. Cruz-ß-estructuras contienen densas y ß-hojas-cristalinas como altamente ordenadas estabilizados con enlaces de hidrógeno 3,4. Amiloides priónicas puede auto-replicarse debido a los beta-capítulos en el borde de crecimiento que proporcionan una plantilla para el reclutamiento y la conversión de una unidad de proteína monomérica. De acuerdo con la hipótesis de &quot;única proteína&quot;, el confórmero de amiloide de la proteína prión es el único agente infeccioso. Sin embargo, se han propuesto algunas otras biomoléculas ser esencial para los trastornos por priones. Por ejemplo, las membranas celulares se cree que ser un lugar donde conversien su lugar y algunos toma lípidos cargados negativamente se ha demostrado para mejorar el proceso de conversión de 5,6. Además, algunas proteínas también pueden estar implicados en patologías priónicas. En concreto, hay otros dos miembros de la familia de proteínas de priones: Doppel y Shadoo 7,8. Doppel tiene una estructura relativamente rígida estabilizado con puentes di-sulfuro y no autopolimerizarse y el agregado de fibrillas amiloides 9. En contraste, similar a la proteína prión, Shadoo puede adoptar una estructura enriquecida en β-lámina y autoasociarse en estructuras de fibrillas amiloides. Se demostró que Shadoo puede fibrilar en condiciones nativas o tras la unión membranas cargadas negativamente 10,11. La conversión de Shadoo en fibras de tipo amiloide puede estar asociada con patologías. De hecho, los mecanismos por los cuales las estructuras de tipo amiloide causan la enfermedad son poco conocidos. Shadoo tiene un dominio hidrófobo (HD) y una serie de tándem Arg / Gly repite t similareso la parte N-terminal de la proteína prión (Figura 1A). A medida que la parte N-terminal de la proteína prión, Shadoo está altamente cargado positivamente y parece ser una proteína nativa no estructurada 11,12. Shadoo parece ser funcionalmente relacionadas con los trastornos por priones, ya que puede unirse directamente la proteína del prión. Además, su expresión es regulada hacia abajo durante la patología prión 13,14. Sin embargo, el papel de Shadoo en la enfermedad priónica todavía no se ha establecido. Hemos desarrollado un plásmido que porta la secuencia de codificación del gen Shadoo ratón. El plásmido se utilizó para transformar E. coli para la producción de N-terminal Su proteína Shadoo 6 de fusión. Este sistema de expresión está bien establecida en nuestro laboratorio y se utiliza comúnmente en nuestros proyectos en curso 6,15,16. Una cuestión importante para la expresión de Shadoo es la elección de la E. coli cepa. Mientras cepa bacteriana BL21 competente se utiliza comúnmente para la expresión de pro recombinanteproteínas Shadoo se expresó y se purifica sólo de la cepa bacteriana transformada SoluBL21 éxito. SoluBL21 E. competente coli es un mutante mejorada de cepa huésped BL21 desarrollado para la producción de proteínas cuya expresión en la BL21 padre no dio producto soluble detectable. Una expresión de alto nivel de Shadoo en SoluBL21 E. coli conduce a la acumulación de la proteína en cuerpos de inclusión. Como característica general, cuando una proteína no nativa es altamente expresado en E. coli, esta proteína tiende a acumularse en los cuerpos de inclusión insolubles. Shadoo probablemente agregados a través de interacciones hidrófobas no covalentes o iónicos (o una combinación de ambos) para estructuras dinámicas altamente enriquecido formadas por la proteína plegada en diversos grados. En consecuencia, la purificación comprende al menos dos etapas: (i) una separación selectiva de la proteína a partir de otras biomoléculas en un medio de desnaturalización, y (ii) una renaturalización de la proteína purificada utilizando en el plegamiento in vitrotécnicas. La separación selectiva de Shadoo se logró en una solución tampón que contiene urea 8 M (o, alternativamente, guanidina-HCl 6 M). La eliminación de urea y de la renaturalización de la proteína se puede hacer mediante la aplicación de diversos protocolos de: (i) la renaturalización en una solución de pH ácido para obtener una proteína Shadoo monomérica no estructurada, o (ii) la renaturalización en una solución de pH ≥ 7 para obtener Shadoo polimerizado en fibras amiloides estables con motivos característicos cruz β-hoja.

<table><tbody><tr><td>AKTA FPLC&amp;nbsp;</td><td>GE, Amersham</td><td># 1363</td><td></td></tr><tr><td>HiLoad 16/60 Superdex</td><td>GE Healthcare</td><td>17-1069-01</td><td></td></tr><tr><td>HiTrap IMAC</td><td>GE Healthcare</td><td>GE17-0920-05</td><td></td></tr><tr><td>HiPrep26/10 Desalting column</td><td>GE Healthcare</td><td>GE17-5087-01</td><td></td></tr><tr><td>SoluBL21 Competent E. coli</td><td>Genlantis</td><td>C700200</td><td></td></tr><tr><td>pET-28b+</td><td>Novogen</td><td>69865-3</td><td></td></tr><tr><td>IPTG</td><td>Sigma-Aldrich</td><td>I6758</td><td></td></tr><tr><td>LB-Broth medium</td><td>Sigma-Aldrich</td><td>L3022</td><td></td></tr><tr><td>Eppendorf Biophotometar</td><td>Eppendorf</td><td>550507804</td><td></td></tr><tr><td>Trito X-100</td><td>Life Technologies</td><td>85111</td><td></td></tr><tr><td>NiSO4</td><td>Sigma-Aldrich</td><td>656895</td><td></td></tr><tr><td>EDTA</td><td>Sigma-Aldrich</td><td>E6758</td><td></td></tr><tr><td>Tris-HCl</td><td>Sigma-Aldrich</td><td>RES3098T</td><td></td></tr><tr><td>Protease Inhibitor Cocktail Tablets</td><td>Roche</td><td>4693116001</td><td></td></tr><tr><td>NaCl</td><td>Sigma-Aldrich</td><td>746398</td><td></td></tr><tr><td>Imidazol</td><td>Sigma-Aldrich</td><td>I5513</td><td></td></tr><tr><td>Gdn-HCl</td><td>Sigma-Aldrich</td><td>G4505</td><td></td></tr><tr><td>protein size marker&amp;nbsp;</td><td>Thermo Fisher Scientific</td><td>26620</td><td></td></tr></tbody></table>

purification and refolding to amyloid fibrils of (his)6-tagged recombinant shadoo protein expressed as inclusion bodies in e. coli

El sistema de expresión de Escherichia coli es una poderosa herramienta para la producción de proteínas recombinantes eucariotas. Lo utilizamos para producir Shadoo, una proteína perteneciente a la familia de priones. Un método cromatográfico para la purificación de (His) 6-etiquetados Shadoo recombinantes expresadas como cuerpos de inclusión se describe. Los cuerpos de inclusión se solubilizan en 8 M urea y unidos a una columna de Ni 2+ -charged para llevar a cabo la cromatografía de afinidad de iones. Las proteínas unidas se eluyen mediante un gradiente de imidazol. Las fracciones que contienen la proteína Shadoo son sometidas a cromatografía de exclusión por tamaño para obtener una proteína altamente purificada. En la etapa final de Shadoo purificada se desala para eliminar las sales, urea e imidazol. Shadoo proteína recombinante es un reactivo importante para los estudios biofísicos y bioquímicos de los trastornos de la conformación de proteínas que ocurren en las enfermedades priónicas. Muchos informes han demostrado que las enfermedades neurodegenerativas causadas por priones originan a partir de la deposición de puñaladale ordenó fibrillas amiloides. / Se presentan valores de pH básicos protocolos de ejemplo que describen cómo fibrilar Shadoo en fibrillas amiloides en ácido y neutro. Los métodos sobre cómo producir y fibrilar Shadoo puede facilitar la investigación en laboratorios que trabajan sobre las enfermedades priónicas, ya que permite la producción de grandes cantidades de proteína en una manera rápida y de bajo coste.

Acerca de 5-10 mg de proteína purificada Shadoo se obtiene por litro de cultivo bacteriano. Se necesita una purificación de dos pasos para obtener Shadoo recombinante de alta pureza. El primer paso se lleva a cabo mediante cromatografía de afinidad con la columna -charged una de Ni 2+ que conserva sus-proteínas etiquetadas. Las fracciones eluidas se sometieron a SDS-PAGE y se tiñeron con azul brillante de Coomassie (Figura 5A). Las fracciones que contenían la proteína Shadoo se reúnen...

Watch this Scientific Journal Video about Purification and Refolding to Amyloid Fibrils of His6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli at JoVE.com

Purification and Refolding to Amyloid Fibrils of His6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli

A two-step chromatographic method is described for the purification of recombinant Shadoo protein expressed as inclusion bodies in Escherichia coli, as well as a protocol to fibrillate purified Shadoo into amyloid structures.

Purificación y replegamiento de amiloide fibrillas de (Su)<sub&gt; 6</sub&gt;-etiquetados proteína recombinante Shadoo Expresado como cuerpos de inclusión en<em&gt; E. coli</em

The Escherichia coli expression system is a powerful tool for the production of recombinant eukaryotic proteins. We use it to produce Shadoo, a protein ...

purification-refolding-to-amyloid-fibrils-his-6-tagged-recombinant

Research

JoVE Journal

Biology

Purification and Refolding to Amyloid Fibrils of (His)6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli

14.2K vistas.  INRA. A two-step chromatographic method is described for the purification of recombinant Shadoo protein expressed as inclusion bodies in Escherichia coli, as well as a protocol to fibrillate purified Shadoo into amyloid structures. 

Video: Purification and Refolding to Amyloid Fibrils of His6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli

Selection of Aptamers for Amyloid &beta;-Protein, the Causative Agent of Alzheimer&#39;s Disease

Alzheimer's disease (AD) is a progressive, age-dependent, neurodegenerative disorder with an insidious course that renders its presymptomatic diagnosis difficult1. Definite AD diagnosis is achieved only postmortem, thus establishing presymptomatic, early diagnosis of AD is crucial for developing and administering effective therapies2,3.
Amyloid &beta;-protein (A&beta;) is central to AD pathogenesis. Soluble, oligomeric A&beta; assemblies are believed to affect neurotoxicity underlying synaptic dysfunction and neuron loss in AD4,5. Various forms of soluble A&beta; assemblies have been described, however, their interrelationships and relevance to AD etiology and pathogenesis are complex and not well understood6. Specific molecular recognition tools may unravel the relationships amongst A&beta; assemblies and facilitate detection and characterization of these assemblies early in the disease course before symptoms emerge. Molecular recognition commonly relies on antibodies. However, an alternative class of molecular recognition tools, aptamers, offers important advantages relative to antibodies7,8. Aptamers are oligonucleotides generated by in-vitro selection: systematic evolution of ligands by exponential enrichment (SELEX)9,10. SELEX is an iterative process that, similar to Darwinian evolution, allows selection, amplification, enrichment, and perpetuation of a property, e.g., avid, specific, ligand binding (aptamers) or catalytic activity (ribozymes and DNAzymes).
Despite emergence of aptamers as tools in modern biotechnology and medicine11, they have been underutilized in the amyloid field. Few RNA or ssDNA aptamers have been selected against various forms of prion proteins (PrP)12-16. An RNA aptamer generated against recombinant bovine PrP was shown to recognize bovine PrP-&beta;17, a soluble, oligomeric, &beta;-sheet-rich conformational variant of full-length PrP that forms amyloid fibrils18. Aptamers generated using monomeric and several forms of fibrillar &beta;2-microglobulin (&beta;2m) were found to bind fibrils of certain other amyloidogenic proteins besides &beta;2m fibrils19. Ylera et al. described RNA aptamers selected against immobilized monomeric A&beta;4020. Unexpectedly, these aptamers bound fibrillar A&beta;40. Altogether, these data raise several important questions. Why did aptamers selected against monomeric proteins recognize their polymeric forms? Could aptamers against monomeric and/or oligomeric forms of amyloidogenic proteins be obtained? To address these questions, we attempted to select aptamers for covalently-stabilized oligomeric A&beta;4021 generated using photo-induced cross-linking of unmodified proteins (PICUP)22,23. Similar to previous findings17,19,20, these aptamers reacted with fibrils of A&beta; and several other amyloidogenic proteins likely recognizing a potentially common amyloid structural aptatope21. Here, we present the SELEX methodology used in production of these aptamers21.

Selection of Aptamers for Amyloid &#946;-Protein, the Causative Agent of Alzheimer's Disease

Aptamers are short ribo-/deoxyribo-oligonucleotides selected by in-vitro evolution methods based on affinity for a specific target. Aptamers are molecular recognition tools with versatile therapeutic, diagnostic, and research applications. We demonstrate methods for selection of aptamers for amyloid &beta;-protein, the causative agent of Alzheimer's disease.

Selección de los aptámeros de amiloide β-proteínas, el agente causante de la enfermedad de Alzheimer

Alzheimer's disease (AD) is a progressive, age-dependent, neurodegenerative disorder with an insidious course that renders its presymptomatic diagnosis ...

Investigación

Neurociencias

A Tailored HPLC Purification Protocol That Yields High-purity Amyloid Beta 42 and Amyloid Beta 40 Peptides, Capable of Oligomer Formation

Amyloidogenic peptides such as the Alzheimer's disease-implicated Amyloid beta (A&#946;), can present a significant challenge when trying to obtain high purity material. Here we present a tailored HPLC purification protocol to produce high-purity amyloid beta 42 (A&#946;42) and amyloid beta 40 (A&#946;40) peptides. We have found that the combination of commercially available hydrophobic poly(styrene/divinylbenzene) stationary phase, polymer laboratory reverse phase - styrenedivinylbenzene (PLRP-S) under high pH conditions, enables the attainment of high purity (&gt;95%) A&#946;42 in a single chromatographic run. The purification is highly reproducible and can be amended to both semi-preparative and analytical conditions depending upon the amount of material wished to be purified. The protocol can also be applied to the A&#946;40 peptide with identical success and without the need to alter the method.

Herein we report a tailored HPLC purification protocol that yields high-purity amyloid beta 42 (A&#946;42) and amyloid beta 40 (A&#946;40) peptides, capable of oligomer formation. Amyloid beta is a highly aggregation prone, hydrophobic peptide implicated in Alzheimer&#39;s disease. The amyloidogenic nature of the peptide makes its purification a challenge.

Un protocolo de purificación HPLC Tailored que los rendimientos de alta pureza beta amiloide 42 y 40 péptidos beta amiloide, capaz de Formación de oligómeros

Amyloidogenic peptides such as the Alzheimer's disease-implicated Amyloid beta (A&#946;), can present a significant challenge when trying to obtain high ...

Bioquímica

Method for Efficient Refolding and Purification of Chemoreceptor Ligand Binding Domain

Identification of natural ligands of chemoreceptors and structural studies aimed at elucidation of the molecular basis of the ligand specificity can be greatly facilitated by the production of milligram amounts of pure, folded ligand binding domains. Attempts to heterologously express periplasmic ligand binding domains of bacterial chemoreceptors in Escherichia coli (E. coli) often result in their targeting into inclusion bodies. Here, a method is presented for protein recovery from inclusion bodies, its refolding and purification, using the periplasmic dCACHE ligand binding domain of Campylobacter jejuni (C. jejuni) chemoreceptor Tlp3 as an example. The approach involves expression of the protein of interest with a cleavable His6-tag, isolation and urea-mediated solubilisation of inclusion bodies, protein refolding by urea depletion, and purification by means of affinity chromatography, followed by tag removal and size-exclusion chromatography. The circular dichroism spectroscopy is used to confirm the folded state of the pure protein. It has been demonstrated that this protocol is generally useful for production of milligram amounts of dCACHE periplasmic ligand binding domains of other bacterial chemoreceptors in a soluble and crystallisable form.

A procedure is presented for the refolding of the dCACHE periplasmic ligand binding domain of Campylobacter jejuni chemoreceptor Tlp3 from inclusion bodies and the purification to yield milligram quantities of protein.

Método para Refolding eficiente y la purificación del quimioreceptor ligando vinculante dominio

Identification of natural ligands of chemoreceptors and structural studies aimed at elucidation of the molecular basis of the ligand specificity can be ...

Screening for Amyloid Aggregation by Semi-Denaturing Detergent-Agarose Gel Electrophoresis

Amyloid aggregation is associated with numerous protein misfolding pathologies and underlies the infectious properties of prions, which are conformationally self-templating proteins that are thought to have beneficial roles in lower organisms.  Amyloids have been notoriously difficult to study due to their insolubility and structural heterogeneity.  However, resolution of amyloid polymers based on size and detergent insolubility has been made possible by Semi-Denaturing Detergent-Agarose Gel Electrophoresis (SDD-AGE).  This technique is finding widespread use for the detection and characterization of amyloid conformational variants.  Here, we demonstrate an adaptation of this technique that facilitates its use in large-scale applications, such as screens for novel prions and other amyloidogenic proteins.  The new SDD-AGE method uses capillary transfer for greater reliability and ease of use, and allows any sized gel to be accomodated.  Thus, a large number of samples, prepared from cells or purified proteins, can be processed simultaneously for the presence of SDS-insoluble conformers of tagged proteins.

SDD-AGE is a useful technique for the detection and characterization of amyloid-like polymers in cells. Here we demonstrate an adaptation that makes this technique amenable to large-scale applications.

La detección de la agregación amiloide de Semi-desnaturalización electroforesis en gel de agarosa-detergente

Amyloid aggregation is associated with numerous protein misfolding pathologies and underlies the infectious properties of prions, which are ...

Biología

Purification and Aggregation of the Amyloid Precursor Protein Intracellular Domain

Amyloid precursor protein (APP) is a type I transmembrane protein associated with the pathogenesis of Alzheimer's disease (AD). APP is characterized by a large extracellular domain and a short cytosolic domain termed the APP intracellular domain (AICD). During maturation through the secretory pathway, APP can be cleaved by proteases termed &alpha;, &beta;, and &gamma;-secretases1. Sequential proteolytic cleavage of APP with &beta; and &gamma;-secretases leads to the production of a small proteolytic peptide, termed A&beta;, which is amyloidogenic and the core constituent of senile plaques. The AICD is also liberated from the membrane after secretase processing, and through interactions with Fe65 and Tip60, can translocate to the nucleus to participate in transcription regulation of multiple target genes2,3. Protein-protein interactions involving the AICD may affect trafficking, processing, and cellular functions of holo-APP and its C-terminal fragments. We have recently shown that AICD can aggregate in vitro, and this process is inhibited by the AD-implicated molecular chaperone ubiquilin-14. Consistent with these findings, the AICD has exposed hydrophobic domains and is intrinsically disordered in vitro5,6, however it obtains stable secondary structure when bound to Fe657. We have proposed that ubiquilin-1 prevents inappropriate inter- and intramolecular interactions of AICD, preventing aggregation in vitro and in intact cells4. While most studies focus on the role of APP in the pathogenesis of AD, the role of AICD in this process is not clear. Expression of AICD has been shown to induce apoptosis8, to modulate signaling pathways9, and to regulate calcium signaling10. Over-expression of AICD and Fe65 in a transgenic mouse model induces Alzheimer's like pathology11, and recently AICD has been detected in brain lysates by western blotting when using appropriate antigen retrieval techniques12. To facilitate structural, biochemical, and biophysical studies of the AICD, we have developed a procedure to produce recombinantly large amounts of highly pure AICD protein. We further describe a method for inducing the in vitro thermal aggregation of AICD and analysis by atomic force microscopy. The methods described are useful for biochemical, biophysical, and structural characterization of the AICD and the effects of molecular chaperones on AICD aggregation.

A method for large-scale purification of the APP intracellular domain (AICD) is described. We also describe methodology to induce in vitro AICD aggregation and visualization by atomic force microscopy. The methods described are useful for biochemical/structural characterization of the AICD and the effects of molecular chaperones on its aggregation.

La purificación y la agregación de la proteína precursora amiloide del dominio intracelular

Amyloid precursor protein (APP) is a type I transmembrane protein associated with the pathogenesis of Alzheimer's disease (AD). APP is characterized by a ...

Medicina

Expression, Purification, Crystallization, and Enzyme Assays of Fumarylacetoacetate Hydrolase Domain-Containing Proteins

Fumarylacetoacetate hydrolase (FAH) domain-containing proteins (FAHD) are identified members of the FAH superfamily in eukaryotes. Enzymes of this superfamily generally display multi-functionality, involving mainly hydrolase and decarboxylase mechanisms. This article presents a series of consecutive methods for the expression and purification of FAHD proteins, mainly FAHD protein 1 (FAHD1) orthologues among species (human, mouse, nematodes, plants, etc.). Covered methods are protein expression in E. coli, affinity chromatography, ion exchange chromatography, preparative and analytical gel filtration, crystallization, X-ray diffraction, and photometric assays. Concentrated protein of high levels of purity (&#62;98%) may be employed for crystallization or antibody production. Proteins of similar or lower quality may be employed in enzyme assays or used as antigens in detection systems (Western-Blot, ELISA). In the discussion of this work, the identified enzymatic mechanisms of FAHD1 are outlined to describe its hydrolase and decarboxylase bi-functionality in more detail.

Expression and purification of fumarylacetoacetate hydrolase domain-containing proteins is described with examples (expression in E. coli, FPLC). Purified proteins are used for crystallization and antibody production and employed for enzyme assays. Selected photometric assays are presented to display the multi-functionality of FAHD1 as oxaloacetate decarboxylase and acylpyruvate hydrolase.

Expresión, purificación, cristalización y ensayos enzimáticos de proteínas que contienen el dominio de la hidrolasa fumarilacetoacetato

Fumarylacetoacetate hydrolase (FAH) domain-containing proteins (FAHD) are identified members of the FAH superfamily in eukaryotes. Enzymes of this ...

Purification of Hsp104, a Protein Disaggregase

Hsp104 is a hexameric AAA+ protein1 from yeast, which couples ATP hydrolysis to protein disaggregation2-10 (Fig. 1). This activity imparts two key selective advantages. First, renaturation of disordered aggregates by Hsp104 empowers yeast survival after various protein-misfolding stresses, including heat shock3,5,11,12. Second, remodeling of cross-beta amyloid fibrils by Hsp104 enables yeast to exploit myriad prions (infectious amyloids) as a reservoir of beneficial and heritable phenotypic variation13-22. Remarkably, Hsp104 directly remodels preamyloid oligomers and amyloid fibrils, including those comprised of the yeast prion proteins Sup35 and Ure223-30. This amyloid-remodeling functionality is a specialized facet of yeast Hsp104. The E. coli orthologue, ClpB, fails to remodel preamyloid oligomers or amyloid fibrils26,31,32.
Hsp104 orthologues are found in all kingdoms of life except, perplexingly, animals. Indeed, whether animal cells possess any enzymatic system that couples protein disaggregation to renaturation (rather than degradation) remains unknown33-35. Thus, we and others have proposed that Hsp104 might be developed as a therapeutic agent for various neurodegenerative diseases connected with the misfolding of specific proteins into toxic preamyloid oligomers and amyloid fibrils4,7,23,36-38. There are no treatments that directly target the aggregated species associated with these diseases. Yet, Hsp104 dissolves toxic oligomers and amyloid fibrils composed of alpha-synuclein, which are connected with Parkinson's Disease23 as well as amyloid forms of PrP39. Importantly, Hsp104 reduces protein aggregation and ameliorates neurodegeneration in rodent models of Parkinson's Disease23 and Huntington's disease38. Ideally, to optimize therapy and minimize side effects, Hsp104 would be engineered and potentiated to selectively remodel specific aggregates central to the disease in question4,7. However, the limited structural and mechanistic understanding of how Hsp104 disaggregates such a diverse repertoire of aggregated structures and unrelated proteins frustrates these endeavors30,40-42.
To understand the structure and mechanism of Hsp104, it is essential to study the pure protein and reconstitute its disaggregase activity with minimal components. Hsp104 is a 102kDa protein with a pI of ~5.3, which hexamerizes in the presence of ADP or ATP, or at high protein concentrations in the absence of nucleotide43-46. Here, we describe an optimized protocol for the purification of highly active, stable Hsp104 from E. coli. The use of E. coli allows simplified large-scale production and our method can be performed quickly and reliably for numerous Hsp104 variants. Our protocol increases Hsp104 purity and simplifies His6-tag removal compared to a previous purification method from E. coli47. Moreover, our protocol is more facile and convenient than two more recent protocols26,48.

Here, we describe a protocol for the purification of highly active Hsp104, a hexameric AAA+ protein from yeast, which couples ATP hydrolysis to protein disaggregation. This scheme exploits a His6-tagged construct for affinity purification from E. coli followed by anion-exchange chromatography, His6-tag removal with TEV protease, and size-exclusion chromatography.

La purificación de Hsp104, una proteína Disaggregase

Hsp104 is a hexameric AAA+ protein1 from yeast, which couples ATP hydrolysis to protein disaggregation2-10 (Fig. 1). This activity imparts two key ...

Rapid Generation of Amyloid from Native Proteins In vitro

Proteins carry out crucial tasks in organisms by exerting functions elicited from their specific three dimensional folds. Although the native structures of polypeptides fulfill many purposes, it is now recognized that most proteins can adopt an alternative assembly of beta-sheet rich amyloid. Insoluble amyloid fibrils are initially associated with multiple human ailments, but they are increasingly shown as functional players participating in various important cellular processes. In addition, amyloid deposited in patient tissues contains nonproteinaceous components, such as nucleic acids and glycosaminoglycans (GAGs). These cofactors can facilitate the formation of amyloid, resulting in the generation of different types of insoluble precipitates. By taking advantage of our understanding how proteins misfold via an intermediate stage of soluble amyloid precursor, we have devised a method to convert native proteins to amyloid fibrils in vitro. This approach allows one to prepare amyloid in large quantities, examine the properties of amyloid generated from specific proteins, and evaluate the structural changes accompanying the conversion.

Rapid Generation of Amyloid from Native Proteins In vitro

Proteins can either adopt a native structure or misfold into insoluble amyloid. Conditions that favor the misfolding pathway lead to the formation of different types of amyloid fibrils. The methods described here allow rapid conversion of native proteins into amyloid in vitro.

Proteins carry out crucial tasks in organisms by exerting functions elicited from their specific three dimensional folds. Although the native structures ...

Biochemical Purification and Proteomic Characterization of Amyloid Fibril Cores from the Brain

Proteinaceous fibrillar inclusions are key pathological hallmarks of multiple neurodegenerative diseases. In the early stages of Alzheimer&#39;s disease (AD), amyloid-beta peptides form protofibrils in the extracellular space, which act as seeds that gradually grow and mature into large amyloid plaques. Despite this basic understanding, current knowledge of the amyloid fibril structure, composition, and deposition patterns in the brain is limited. One major barrier has been the inability to isolate highly purified amyloid fibrils from brain extracts. Affinity purification and laser capture microdissection-based approaches have been previously used to isolate amyloids but are limited by the small quantity of material that can be recovered. This novel, robust protocol describes the biochemical purification of amyloid plaque cores using sodium dodecyl sulfate (SDS) solubilization with sucrose density gradient ultracentrifugation and ultrasonication and yields highly pure fibrils from AD patients and AD model brain tissues. Mass spectrometry (MS)-based bottom-up proteomic analysis of the purified material represents a robust strategy to identify nearly all the primary protein components of amyloid fibrils. Previous proteomic studies of proteins in the amyloid coronae have revealed an unexpectedly large and functionally diverse collection of proteins. Notably, after refining the purification strategy, the number of co-purifying proteins was reduced by more than 10-fold, indicating the high purity of the isolated SDS insoluble material. Negative staining and immuno-gold electron microscopy allowed confirmation of the purity of these preparations. Further studies are required to understand the spatial and biological attributes that contribute to the deposition of these proteins into amyloid inclusions. Taken together, this analytical strategy is well-positioned to increase the understanding of amyloid biology.

This biochemical purification method with mass spectrometry-based proteomic analysis facilitates the robust characterization of amyloid fibril cores, which may accelerate the identification of targets for preventing Alzheimer's disease.

Purificación bioquímica y caracterización proteómica de núcleos de fibrillas amiloides del cerebro

Proteinaceous fibrillar inclusions are key pathological hallmarks of multiple neurodegenerative diseases. In the early stages of Alzheimer&#39;s disease ...

Isolation of Amyloid Fibrils from Brain Tissue Extract

Source: Upadhyay, A. et al., <a href="https://app.jove.com/v/63816">Biochemical Purification and Proteomic Characterization of Amyloid Fibril Cores from the Brain.</a> J. Vis. Exp. (2022)
This video demonstrates the protocol for isolating&#160; amyloid fibrils from mouse brain tissue extract using density gradient centrifugation and digestion of non-amyloid proteins.

Aislamiento de fibrillas de amiloide a partir de extracto de tejido cerebral

All procedures involving animal samples have been reviewed and approved by the appropriate animal ethical review committee.
1. Tissue harvesting and ...

Purificación y replegamiento de amiloide fibrillas de (Su)

Resumen

Explorar más videos

Selección de los aptámeros de amiloide β-proteínas, el agente causante de la enfermedad de Alzheimer

Un protocolo de purificación HPLC Tailored que los rendimientos de alta pureza beta amiloide 42 y 40 péptidos beta amiloide, capaz de Formación de oligómeros

Método para Refolding eficiente y la purificación del quimioreceptor ligando vinculante dominio

La detección de la agregación amiloide de Semi-desnaturalización electroforesis en gel de agarosa-detergente

La purificación y la agregación de la proteína precursora amiloide del dominio intracelular

Expresión, purificación, cristalización y ensayos enzimáticos de proteínas que contienen el dominio de la hidrolasa fumarilacetoacetato

La purificación de Hsp104, una proteína Disaggregase

Rapid Generation of Amyloid from Native Proteins In vitro

Purificación bioquímica y caracterización proteómica de núcleos de fibrillas amiloides del cerebro

Aislamiento de fibrillas de amiloide a partir de extracto de tejido cerebral