The authors would like to acknowledge Natalie Doude and David Westerway (University of Alberta) for providing us Sho cDNA, Christophe Chevalier (INRA) for plasmid construction, Michel Br&#233;mont (INRA) for providing us BL21Sol bacteria; Christine Longin (INRA) for TEM assistance and Edith Pajot-Augy (INRA) for comments and proofreading.

Plazmid ve Shadoo İfade 1. Üretim Not: Gen kodlayan sıçangil Shadoo protein (Shadoo 25-122), ekspresyon vektörü pET-28 11 içine alt klonlandı. Bu klon, E. dönüştürüldü Daha önce açıklandığı gibi, 11 coli, bir N-ucu heksahistidin etiketi, (HHHHHHHHHHSSGHIDDDDKHMKGGRGGARGSARGVRGGARGASRVRVRP APRYGSSLRVAAAGAAAGAAAGVAAGLATGSGWRRTSGPGELGLEDDENGAMGGNGTDRGVYSYWAWTSG) ile Shadoo proteinini ifade etmek için, bir bakteri suşunun SoluBL21. Plazmid yazarlarından talep edilebilir. Amino asit dizisinden hesaplanan Shadoo molekül ağırlığı 12,243.2 Da&#39;dır. Not: Bir laminal akış kaputu altında veya yakınında Bunsen aleve bakteriler ile tüm manipülasyonlar gerçekleştirin. <ol><li> Standart ısı şok protokolü kullanarak, pET-28-His 6 -Shadoo plazmid ile yetkili SoluBL21 bakteri Transform. Plazmid 1 5 ul bu karışıma için (tipik olarak 10 pg ile 100Bir tüp içinde bakteri 50 ul halinde ng). 45 saniye için 42 ° C &#39;de bir ısı şoku gerçekleştirin. </li><li> Kültür 40 mg / ml kanamisin (Şekil 1B) ile takviye edilmiş Luria-Bertani ortamında 0.5-0.7 arasında bir 600 kadar 37 ° C &#39;de bakteri dönüştürdü. </li><li> Kültür, 240 ug / ml izopropil-β-D-tiogalaktopiranosid, ITPG ekleyerek Shadoo sentezleme O / N neden. 37 ° C&#39;de 150 rpm&#39;de çalkalanarak kültür bakterileri. Not: Genellikle, bakteri kültürü 600 3 O / N ulaşır. Not: Transforme bakteriler sonraki protein üretimi için -80 ° C &#39;de muhafaza edilebilir. Bunun için, bakteri kültürü kısma 10% -50% (v / v) steril gliserol ekleyin ve -80 ° C&#39;de dondurmak. </li></ol><img alt="figür 1" src="/files/ftp_upload/53432/53432fig1.jpg" /> Shadoo ifade Shadoo sentezleme konstruktu, bakteri dönüşüm ve indüksiyon Şekil 1, Şema (aşama 1 olarak tarif edilmiştir). </strong&gt; (A) Shadoo için ekspresyon yapısı, bir protein, Nt N-terminalinde kaynaşmış bir hekzahistidin etiketi kodlar. Düzeni Shadoo proteini C-ucu (Ct), ardından bazik arginin / glisin tekrarları (yeşil silindir), bir hidrofobik domain (HD), ve tek bir N-glikosilasyon sitesi (CHO) içerdiğini göstermektedir. (B), pET-28-His 6 -Shadoo plazmid 42 ° C&#39;de 45 saniye boyunca ısı şoku ile SoluBL21 bakterilerin içine transforme edilir. Dönüştürülen bakteriler, seçici agar / ml kanamisin ihtiva eden 40 ug ekilir. Levhasından tek bir koloni, bir 1,000-3,000 ml&#39;lik bir çalkalama şişesinde bir kültürü inoküle etmek için kullanılır. Rekombinant proteinin ifadesi 1 mM IPTG ile uyarılır. <a href="https://www.jove.com/files/ftp_upload/53432/53432fig1highres.jpg" target="_blank">Bu rakamın büyük halini görmek için lütfen buraya tıklayınız.</a> Düşük Basınçlı Sıvı Kromatografisi Shadoo Protein 2. saflaştırma (LPLC) <ol><li> Hücre parçalama ve deetme gövdelerinin hazırlık <ol><li> Bakteri süspansiyonu toplayın ve santrifüj tüpleri (Şekil 2) içine aktarın. </li><li> 4 ° C&#39;de 20 dakika boyunca 2500 x g&#39;de Spin. Dekantasyon ve hücre kültürü 500 ml elde edilen her bir pelet için tekrar süspansiyon peletler (anti-proteaz kokteyli ile 50 mM Tris, 10 mM EDTA, pH 8) 15 ml tampon maddesi içinde süpernatantı. Not: Tekrar süspansiyon haline getirilen topaklar dondurulmuş ve birkaç gün boyunca -20 ° C&#39;de saklanabilir. Donma bakteri hücreleri lizisini kolaylaştırır. </li><li> SDS-PAGE analizi ve Coomassie boyama Ham bakteri pelet kullanılarak rekombinant proteinin aşırı ekspresyonunu kontrol edin. <ol><li> Bunun için, bakteri kültürü santrifüj 1 mi pelet hücreleri. 5 dakika boyunca 100 ° C &#39;de 100 ul Laemmli denatürasyon: pelet çözeltisi (277,8 mM Tris-HCl, pH 6.8,% 4.4 SDS,% 44.4 w / v gliserol,% 0.02 bromofenol) ile ısıtılır. </li><li> % 12 akrilamid jeline Yük örnek 10 ul, çalışma SDS-PAGE ve visualize Coomassie boyaması proteinleri ayrıldı. </li></ol></li><li> ) 2.1.2 tamamen yeniden süspanse pelet% 0.5 nihai konsantrasyona kadar Triton X-100 ekleyin. </li><li> 30 dakika boyunca 37 ° C&#39;de su banyosu içinde süspansiyon inkübe edin. </li><li> Bakteriyel hücreler lize edildi, buz soğukluğunda su içinde 6-12 mikron tepe-tepe genlik 5 dakika boyunca bir süspansiyon sonikasyon. </li><li> Aktarım, temiz 50 ml&#39;lik santrifüj tüpleri içine süspansiyon sonike edilmiştir. </li><li> 4 ° C&#39;de 15 dakika boyunca 15.000 x g&#39;de santrifüje tüpleri. </li><li> Boşaltma yoluyla Süpernatantı ve tüp başına bağlanma tamponu (20 mM Tris-HCl tamponu, pH 7,4, 0,5 M NaCl, 8 M Üre, 5 mM İmidazol) kullanılarak, 5 ml ilave edin. </li><li> Dönen tekerlek O / N yerleştirin tüpleri tamamen cisimcikler proteinleri tekrar süspansiyon. </li></ol><img alt="Şekil 2," src="/files/ftp_upload/53432/53432fig2.jpg" /> Içerme arınma Şekil 2. ŞemaShadoo eksprese organları (adım 2.1 de tarif edildiği gibi). Transforme bakteriler santrifüje tabi tutularak toplanmış ve liziz tamponunda yeniden süspanse edilir. Süspansiyon 30 dakika için 37 ° C sıcaklıkta inkübe edilir ve daha sonra mekanik olarak bakteriyel hücreler kırmak için ses dalgalarına tabi tutulur. Sonikasyon örnek ısınmasını önlemek için buz üzerinde yapılır. Kırık hücreler santrifüj ile toplanır ve inklüzyon cisimciklerinin proteinleri çözünür 8 M üre ihtiva eden bir tampon içinde tekrar süspanse edilir. <a href="https://www.jove.com/files/ftp_upload/53432/53432fig2highres.jpg" target="_blank">Bu rakamın büyük halini görmek için lütfen buraya tıklayınız.</a> </li><li> Ni2 + -affinity kromatografisi Not: Kromatografi 5 mi Sefaroz kenetleme kolonu (Şekil 3A), bir Ni 2+ -yüklü kullanılarak FPLC Sistemi üzerinde gerçekleştirilmiştir. Bütün çözeltiler 1 ml / dakika bir akış oranı ile sütun üzerine yüklenir. <ol><li> Şarj etmek için Sepharose sütuna 0.2 M Niso 4 su çözeltisi 10 ml enjekteNi 2+ -ions ile. </li><li> Imidazol düşük konsantrasyonda (20 mM Tris-HCl tamponu, pH 7,4, 0,5 M NaCl, 8 M Üre, 5 mM İmidazol) ihtiva eden bağlama tamponu 30-50 ml enjekte edilmesi ile Ni2 + -ions görevli sütun dengelenmesi. </li><li> 50 ml&#39;lik enjeksiyon döngüsü ile üre çözünebilir proteinleri yükleyin. </li><li> İyice bağlanmamış proteinin maksimum çıkarmak için 10 mi, düşük imidazol bağlanma tamponu (20 mM Tris-HCl tamponu, pH 7.4, 0.5 M NaCI, 8 M Üre, 5 mM İmidazol) ile yıkanması sureti ile akış geçiş kısmını kurtarma kolondan. </li><li> (MM Tris-HCI, pH 7.4, 0.5 M NaCl, 8 M üre, 80 mM imidazol 20) spesifik olmayan Sütuna bağlanmış proteinler elüt edilmesi için yıkama tamponu 50-100 ml sütun yıkayın. </li><li> 20 mM Tris-HCl, pH 7.4, 0.5 M NaCl, 8 M üre ihtiva eden tampon maddesi içinde 80-800 mM imidazol 15 dakika lineer gradyan uygulanır. Degrade uygulama sırasında 1 ml kesirler toplayın. Not: His-etiketli proteinleri wit elüte edilir(a rakip olarak kullanılabilir) imidazol ihtiva eden tampon ha gradyanı. </li><li> (2.1.3.1 bakınız) Her bir fraksiyonun bir 8 ul tablet alın ve 4 ul 4x Laemmli denatürasyon çözeltisi ilave edilir. 5 dakika boyunca 100 ° C&#39;de ısı çözümler. </li><li> Yük Coomassie boyama ile protein boyut işaretleyici 10 ul% 12 akrilamid jeline her numunenin 10 ul, çalışma SDS-PAGE ve görselleştirmek ayrılan proteinler. Not: hesaplanan Shadoo molekül ağırlığı, amino asit sekansı 12,243.2 Da&#39;dır oluştururlar. </li><li> Havuz Shadoo içeren tüm fraksiyonlar. </li></ol><img alt="Şekil 3," src="/files/ftp_upload/53432/53432fig3.jpg" /> (Adımları 2.2-2.4 de tarif edildiği gibi) 3. saflaştırma prosedürü Şekil. (A) Ni2 + -ions polihistidin ile işaretlenmiş olan proteinlerin seçici olarak temizlenmesini mümkün kılmaktadır histidin artığının koordine edilebilir. İmidazol ile, protein elüt edilmesi için kullanılmaktadırNi2 + -iyon ile koordine ve bağlı proteinin yerini yeteneğidir. (B) bir ebat eksklüzyon kolonu üzerine ayrılır Sütunlu Ni 2+ üzerinde tutulan edildi değişen hidrodinamik radius proteinler. Proteinler küçük olanlar büyük elüte edilir. (C) Kullanımdan önce, Shadoo ihtiva eden fraksiyonlar bir araya toplanmış ve üre, imidazol ve tuzları yok etmek için tuzdan arındırılmıştır edilir. Kalite kontrol deneyleri SDS-PAGE / Coomassie lekeleme, Western blotlama içerir. Saflaştırılmış Shadoo dondurularak kurutulabilir. -20 ° C&#39;de saklandığında Liyofilize Shadoo ay boyunca stabildir. <a href="https://www.jove.com/files/ftp_upload/53432/53432fig3highres.jpg" target="_blank">Bu rakamın büyük halini görmek için lütfen buraya tıklayınız.</a> </li><li> Ebat eksklüzyon kromatografı Not: İkinci bir saflaştırma adımı diğer proteinler, birinci saflaştırma aşaması sırasında birlikte elüt gelen Shadoo proteini ayıran boyut dışlama kromatografisi oluşur(Şekil 3B). <ol><li> 1,5 ml / dakika akış hızında 20 mM Tris-HCI tamponu, pH 7.4, 0.5 M NaCI, 8 M Üre, 250 ml enjekte edilerek toplam yatak hacmi 120 ml Superdex sütunu dengelenmesi. </li><li> Dengelenmiş sütun üzerinde 2.2.9 den Shadoo ihtiva eden yükleme Bir araya toplanan fraksiyonlar. Yukarıda bahsedilen tampon maddenin sürekli bir akımının meydana getirilmesi üzerine 40 ml sütun boşluk hacmi sonra, 1 ml&#39;lik fraksiyonların toplayın. </li><li> Her bir fraksiyonun bir 10 ul tablet alın ve fraksiyonlar Shadoo içeren olduğunu öğrenmek için yukarıda tarif edildiği gibi SDS-PAGE analizi ve Coomassie boyama yapar. </li><li> Shadoo ihtiva eden fraksiyonlar Havuz. </li></ol></li><li> Tuzdan arındırma Not: tuz giderme işlemi daha biyofiziksel ve biyokimyasal çalışmalar (Şekil 3C) için uygun olan bir tampon maddesi içinde rekombinant Shadoo proteini elde etmek üzere tuzlar, imidazol ve üre kaldırır. Aynı sonuç tampon maddesine karşı diyaliz örnekleri ile elde edilebilir. <ol><li> 150 ml 53 ml &#39;lik bir tuz giderme kolonu dengeye/ dakika, 5 ml akış hızında 10 mM amonyum asetat tamponu, pH 5, arasında. </li><li> Yük kolonu üzerinde Shadoo fraksiyonlar havuzlandı. Amonyum asetat tamponu enjeksiyonu üzerine elle UV detektörü çıkışında 280 nm&#39;de sinyal bir artış olduğunu göstermektedir fraksiyonlarım toplamak. </li><li> -Freeze kurutmak tuzu giderilmiş Shadoo ve -20 ° C&#39;de saklayın. </li><li> Uygun bir tampon maddesi içinde liyofilize Shadoo, örneğin 10 mM sodyum asetat tamponu, pH 5 içinde çözündürülür, kullanımdan önce. Not: polihistidin etiketi enterokinaz ile temizlenebilir. </li></ol></li></ol> Fizyolojik pH&#39;da Amiloid fibrillerin içine Shadoo in vitro bir araya 3. Not: kendiliğinden Shadoo Protein topakları gece boyunca pH ≥ 7 11 de fibriller oluşturur. <img alt="Şekil 4," src="/files/ftp_upload/53432/53432fig4.jpg" /> Shadoo amiloid fibrillere refolding Şekil 4. Programı (descri olarakÇalkalarken bir asidik çözeltinin pH ≥ 7 tampon içinde çözüldüğünde Adım 3&#39;te yatak). Saflaştırılmış Shadoo kendiliğinden amiloid fibrillere dönüştürür Shadoo 1 M Gdn-HCl ile kuluçkaya yatırıldıktan sonra amiloid fibrillere dönüştürür. Kalite kontrol deneyleri, elektronik mikroskop ve ThT boyama bulunmaktadır. <a href="https://www.jove.com/files/ftp_upload/53432/53432fig4highres.jpg" target="_blank">Bu rakamın büyük halini görmek için lütfen buraya tıklayınız.</a> <ol><li> 20 mM Tris-HCI tampon maddesi, pH 7.4 içinde 2 uM&#39;lik bir son konsantrasyona Shadoo seyreltilir. 280 nm &#39;de çözeltinin optik yoğunluğu ölçmek ve 20,970 arasında Shadoo amino asit bileşimi çıkarsanan sönüm katsayısı kullanarak konsantrasyonu ölçümü. </li><li> Amiloid yapılarına (Şekil 4) kendiliğinden protein dönüşümü sağlamak için, bir kaç hafta boyunca 4 ° C &#39;de konik bir plastik tüp içinde solüsyon 500 ul inkübe edin. </li><li> Taze nihai conce, T (ThT), Tioflavin hazırlanabilir ekleShadoo solüsyonu, 100 ul bölüntüde 10 uM ntration. Oda sıcaklığında 5 dakika boyunca çözelti inkübe edin. Amiloid yapılarına 17 varlığını doğrulamak için 435 nm&#39;lik bir eksitasyon dalga boyu kullanılarak 460 520 nm floresan emisyon ölçün. </li></ol> Asidik pH&#39;larda Amiloid fibrillerin için Shadoo in vitro bir araya 4. <ol><li> 2 uM nihai konsantrasyona kadar 1 M GdnHCl, 20 mM Na-asetat tampon, pH 5 Shadoo seyreltilir. </li><li> 3-7 gün boyunca, 37 ° C&#39;de sürekli çalkalanarak konik bir tüp içinde, bu çözeltinin 500 ul inkübe edin. </li><li> 3.3 olarak çözeltisinin bir alikotuna THT ekleyerek Amiloid fibrillerin varlığını kontrol edin. </li><li> Shadoo amiloid fibrillerine arındırmak için, 10 mM Na-asetat tamponu, pH 5.0 karşı elde edilen süspansiyonun Dialyze. </li><li> 4 ° C&#39;de saflaştırılmış fibriller saklayın. </li></ol><img alt="Şekil 5," src="/files/ftp_upload/53432/53432fig5.jpg"/&gt; Ni2 + elüt Şekil 5. Örnek sonuçlanır. Protein fraksiyonlar kenetleme kolonu (A) ve boyut dışlama kolonu (B), SDS-PAGE ve Coomassie boyama ile analiz edilmiştir -yüklü. Saflaştırılmış Shadoo tanımlanması SPRN anti-Shadoo antikoru (C) kullanılarak değerlendirildi. <a href="https://www.jove.com/files/ftp_upload/53432/53432fig5large.jpg" target="_blank">Bu rakamın büyük halini görmek için lütfen buraya tıklayınız.</a>

<ol>
	<li>Biasini, E., Turnbaugh, J. A., Unterberger, U., Harris, D. A. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Prion+protein+at+the+crossroads+of+physiology+and+disease.">Prion protein at the crossroads of physiology and disease.</a> Trends in Neurosciences. 35, 92-103 (2012).</li><li>Colby, D. W., Prusiner, S. B. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=De+novo+generation+of+prion+strains.">De novo generation of prion strains.</a> Nature Reviews. Microbiology. 9, 771-777 (2011).</li><li>Chiti, F., Dobson, C. M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Protein+misfolding,+functional+amyloid,+and+human+disease.">Protein misfolding, functional amyloid, and human disease.</a> Annual Review of Biochemistry. 75, 333-366 (2006).</li><li>Nelson, R., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Structure+of+the+cross-beta+spine+of+amyloid-like+fibrils.">Structure of the cross-beta spine of amyloid-like fibrils.</a> Nature. 435, 773-778 (2005).</li><li>Murphy, R. M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Kinetics+of+amyloid+formation+and+membrane+interaction+with+amyloidogenic+proteins.">Kinetics of amyloid formation and membrane interaction with amyloidogenic proteins.</a> Biochimica et Biophysica Acta. 1768, 1923-1934 (2007).</li><li>Steunou, S., Chich, J. F., Rezaei, H., Vidic, J. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Biosensing+of+lipid-prion+interactions:+insights+on+charge+effect,+Cu(II)-ions+binding+and+prion+oligomerization.">Biosensing of lipid-prion interactions: insights on charge effect, Cu(II)-ions binding and prion oligomerization.</a> Biosensors &amp; Bioelectronics. 26, 1399-1406 (2010).</li><li>Watts, J. C., Westaway, D. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+prion+protein+family:+diversity,+rivalry,+and+dysfunction.">The prion protein family: diversity, rivalry, and dysfunction.</a> Biochimica et Biophysica Acta. 1772, 654-672 (2007).</li><li>Westaway, D., Daude, N., Wohlgemuth, S., Harrison, P. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+PrP-like+proteins+Shadoo+and+Doppel.">The PrP-like proteins Shadoo and Doppel.</a> Topics in Current Chemistry. 305, 225-256 (2011).</li><li>Baillod, P., Garrec, J., Tavernelli, I., Rothlisberger, U. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Prion+versus+doppel+protein+misfolding:+new+insights+from+replica-exchange+molecular+dynamics+simulations.">Prion versus doppel protein misfolding: new insights from replica-exchange molecular dynamics simulations.</a> Biochemistry. 52, 8518-8526 (2013).</li><li>Daude, N., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Wild-type+Shadoo+proteins+convert+to+amyloid-like+forms+under+native+conditions.">Wild-type Shadoo proteins convert to amyloid-like forms under native conditions.</a> Journal of Neurochemistry. 113, 92-104 (2010).</li><li>Li, Q., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Shadoo+binds+lipid+membranes+and+undergoes+aggregation+and+fibrillization.">Shadoo binds lipid membranes and undergoes aggregation and fibrillization.</a> Biochemical and Biophysical Research Communications. 438, 519-525 (2013).</li><li>Watts, J. C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+CNS+glycoprotein+Shadoo+has+PrP(C)-like+protective+properties+and+displays+reduced+levels+in+prion+infections.">The CNS glycoprotein Shadoo has PrP(C)-like protective properties and displays reduced levels in prion infections.</a> The EMBO Journal. 26, 4038-4050 (2007).</li><li>Watts, J. C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Protease-resistant+prions+selectively+decrease+Shadoo+protein.">Protease-resistant prions selectively decrease Shadoo protein.</a> PLoS Pathogens. 7, e1002382 (2011).</li><li>Westaway, D., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Down-regulation+of+Shadoo+in+prion+infections+traces+a+pre-clinical+event+inversely+related+to+PrP(Sc)+accumulation.">Down-regulation of Shadoo in prion infections traces a pre-clinical event inversely related to PrP(Sc) accumulation.</a> PLoS Pathogens. 7, e1002391 (2011).</li><li>Chevalier, C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=PB1-F2+influenza+A+virus+protein+adopts+a+beta-sheet+conformation+and+forms+amyloid+fibers+in+membrane+environments.">PB1-F2 influenza A virus protein adopts a beta-sheet conformation and forms amyloid fibers in membrane environments.</a> The Journal of Biological Chemistry. 285, 13233-13243 (2010).</li><li>Tarus, B., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Oligomerization+paths+of+the+nucleoprotein+of+influenza+A+virus.">Oligomerization paths of the nucleoprotein of influenza A virus.</a> Biochimie. 94, 776-785 (2012).</li><li>Biancalana, M., Koide, S. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Molecular+mechanism+of+Thioflavin-T+binding+to+amyloid+fibrils.">Molecular mechanism of Thioflavin-T binding to amyloid fibrils.</a> Biochimica et Biophysica Acta. 1804, 1405-1412 (2010).</li><li>Minic, J., Sautel, M., Salesse, R., Pajot-Augy, E. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Yeast+system+as+a+screening+tool+for+pharmacological+assessment+of+g+protein+coupled+receptors.">Yeast system as a screening tool for pharmacological assessment of g protein coupled receptors.</a> Current Medicinal Chemistry. 12, 961-969 (2005).</li><li>Schein, C. H. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=A+cool+way+to+make+proteins.">A cool way to make proteins.</a> Nature Biotechnology. 22, 826-827 (2004).</li><li>Sorensen, H. P., Mortensen, K. K. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Advanced+genetic+strategies+for+recombinant+protein+expression+in+Escherichia+coli.">Advanced genetic strategies for recombinant protein expression in Escherichia coli.</a> Journal of Biotechnology. 115, 113-128 (2005).</li><li>Zhang, J., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Disruption+of+glycosylation+enhances+ubiquitin-mediated+proteasomal+degradation+of+Shadoo+in+Scrapie-infected+rodents+and+cultured+cells.">Disruption of glycosylation enhances ubiquitin-mediated proteasomal degradation of Shadoo in Scrapie-infected rodents and cultured cells.</a> Molecular Neurobiology. 49, 1373-1384 (2014).</li><li>Englund, P. T. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+structure+and+biosynthesis+of+glycosyl+phosphatidylinositol+protein+anchors.">The structure and biosynthesis of glycosyl phosphatidylinositol protein anchors.</a> Annual Review of Biochemistry. 62, 121-138 (1993).</li><li>Puig, B., Altmeppen, H., Glatzel, M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+GPI-anchoring+of+PrP:+implications+in+sorting+and+pathogenesis.">The GPI-anchoring of PrP: implications in sorting and pathogenesis.</a> Prion. 8, 11-18 (2014).</li></ol>

The authors have nothing to disclose.

İfade ve rekombinant fare Shadoo proteininin büyük miktarda saflaştırılması hem de kolay ve etkin bir protokol verilmektedir. Anlatılan yöntem başarılı çözülmesini ve (O&#39;nun 6) etiketli rekombinant Shadoo proteinin saflaştırılması verir. Başlığında belirttiği gibi bu, önemli bir prokaryotik bakterinin E. olarak ifade edildiğinde E. coli katma kütlelerinin Shadoo birikir. Shadoo arıtılmadan önce, bakteri Triton X-100 içeren bir tampon içinde sonifikasyon il...

İnsanlarda koyun ve Creutzfeldt-Jakob hastalığında sığır süngersi sığır ensefalopati, skrapisini dahil prion nörodejeneratif hastalıklar, ölümcül ve çaresiz. Prion hastalıkları esas olarak çapraz β-tabaka içine α-helisler oluşan hücresel prion proteininin konformasyonel değişiklikler ile karakterize edilen 1,2 konformer amiloid zenginleştirilmiş. Çapraz β-yapılar yoğun paketlenmiş içeren ve son derece düzenli kristal benzeri β-yaprak hidrojen bağları 3,4 ile stabilize. Prion amiloidleri işe bir şablon sağlamak ve bir monomerik protein birimi dönüştürme büyüyen kenarında β-ipliklerini nedeniyle kendini kopyalayan yapabilirsiniz. &quot;Protein sadece&quot; hipotezine göre, prion proteininin amiloid konformer tek bulaşıcı ajandır. Bununla birlikte, başka bir biyomoleküllerin prion bozukluklarına gerekli olduğu önerilmiştir. Örneğin, hücre zarları, bir yer burada conversi olduğu düşünülmektediryer alır ve bazı negatif yüklü lipidler dönüştürme işlemi, 5,6 artırmak için gösterilmiştir. Buna ek olarak, bazı proteinler de prion patolojilerinde dahil olabilir. Doppel ve Shadoo 7,8: Spesifik olarak, prion proteini ailesinin iki diğer üyeleri vardır. Doppel di-sülfit köprüler ile stabilize nispeten rijit bir yapıya sahiptir ve Amiloid fibrillerin 9 kendi kendine polimerleşme ve agrega başarısız olur. Bunun aksine, prion proteinine benzer Shadoo amiloid fibril yapılarına bir β-tabaka zenginleştirilmiş bir yapı ve kendi kendine ilişkilendirmek alabilir. Bu Shadoo doğal koşullar altında, veya negatif yüklü membranlar 10,11 bağlanması üzerine liflenme denetlenebilir olduğu gösterilmiştir. Amiloid benzeri lif haline Shadoo dönüştürülmesi patolojileri ile ilişkili olabilir. Nitekim, amiloid benzeri yapılar hastalığa neden olan mekanizmalar tam olarak anlaşılamamıştır. Shadoo bir hidrofobik domain (HD) ve tandem Arg / Gly dizisi yer almaktadır içindeki t tekrarlarPrion proteininin (Şekil 1A) N-terminal parçası o. Prion proteininin N-terminal parçası olarak, Shadoo yüksek pozitif yüklü ve doğal olarak yapılandırılmamış bir protein 11,12 olduğu görünür. Doğrudan prion proteininin bağlanabildiği yana Shadoo prion bozukluklarına işlevsel olarak ilişkili gibi görünmektedir. Buna ek olarak, ifade aşağı prion patoloji 13,14 sırasında düzenlenir. Ancak, prion hastalığı Shadoo rolü henüz kurulmuş değildir. Bu fare Shadoo geninin kodlama dizilimini taşıyan bir plazmit geliştirdi. Plasmid E. dönüştürmek için kullanılmış E. coli, N-terminal His 6 füzyon Shadoo proteinin üretimi için. Bu sentezleme sistemi de laboratuvarımızda kurulan ve yaygın devam eden projelerde 6,15,16 kullanılır. Shadoo ekspresyonu için önemli bir husus, E. seçimdir coli suşu. Yetkili BL21 bakteri suşu, rekombinant pro ekspresyonu için kullanılır ikenproteinlerinin Shadoo başarılı bir şekilde eksprese ve transforme SoluBL21 bakteri suşunun sadece saflaştırılmıştır. SoluBL21 yeterli E. E. coli ekspresyonu üst BL21 tespit edilebilir çözünebilir ürün elde proteinlerin üretimi için geliştirilmiş BL21 konak suşunun geliştirilmiş bir mutantıdır. SoluBL21 E. Shadoo yüksek düzeyde tanımlama E. coli katma kütlelerinin protein birikimine yol açar. Olmayan bir doğal proteinin, oldukça E. ifade edilir için genel bir özellik olarak, E. coli, bu protein, erimez içerik korları toplanma eğilimindedir. Shadoo muhtemelen farklı derecelerde katlanmış protein ile oluşturulan zenginleştirilmiş dinamik yapılara kovalent olmayan bir hidrofobik ya da iyonik etkileşimler (ya da her ikisinin bir kombinasyonu) ile toplanır. (I) denatürasyon ortamı içindeki diğer biyomoleküllerin proteinin bir seçici olarak ayrılması, ve (ii) saflaştırılmış proteinin bir renatürasyon in vitro katlanmasına kullanılarak: Sonuç olarak, en azından iki saflaştırma adımları içerirteknikleri. Shadoo seçici ayrılması 8 M üre elde edilmiştir (ya da seçenek olarak 6M Guanidin-HCl) ihtiva eden bir tampon çözeltisi içinde sağlanmıştır. (I) renatürasyon bir asidik pH çözelti içinde polimerize edilmiş Shadoo elde etmek için pH ≥ eden bir çözeltiye, 7 bir yapısal olmayan monomerik Shadoo proteini, ya da (ii) renatürasyon elde etmek üzere üre uzaklaştırılması ve protein renatürasyon çeşitli protokoller uygulanarak yapılabilir Karakteristik çapraz β-yaprak motifleri ile istikrarlı amiloid liflerinin içine.

<table><tbody><tr><td>AKTA FPLC&amp;nbsp;</td><td>GE, Amersham</td><td># 1363</td><td></td></tr><tr><td>HiLoad 16/60 Superdex</td><td>GE Healthcare</td><td>17-1069-01</td><td></td></tr><tr><td>HiTrap IMAC</td><td>GE Healthcare</td><td>GE17-0920-05</td><td></td></tr><tr><td>HiPrep26/10 Desalting column</td><td>GE Healthcare</td><td>GE17-5087-01</td><td></td></tr><tr><td>SoluBL21 Competent E. coli</td><td>Genlantis</td><td>C700200</td><td></td></tr><tr><td>pET-28b+</td><td>Novogen</td><td>69865-3</td><td></td></tr><tr><td>IPTG</td><td>Sigma-Aldrich</td><td>I6758</td><td></td></tr><tr><td>LB-Broth medium</td><td>Sigma-Aldrich</td><td>L3022</td><td></td></tr><tr><td>Eppendorf Biophotometar</td><td>Eppendorf</td><td>550507804</td><td></td></tr><tr><td>Trito X-100</td><td>Life Technologies</td><td>85111</td><td></td></tr><tr><td>NiSO4</td><td>Sigma-Aldrich</td><td>656895</td><td></td></tr><tr><td>EDTA</td><td>Sigma-Aldrich</td><td>E6758</td><td></td></tr><tr><td>Tris-HCl</td><td>Sigma-Aldrich</td><td>RES3098T</td><td></td></tr><tr><td>Protease Inhibitor Cocktail Tablets</td><td>Roche</td><td>4693116001</td><td></td></tr><tr><td>NaCl</td><td>Sigma-Aldrich</td><td>746398</td><td></td></tr><tr><td>Imidazol</td><td>Sigma-Aldrich</td><td>I5513</td><td></td></tr><tr><td>Gdn-HCl</td><td>Sigma-Aldrich</td><td>G4505</td><td></td></tr><tr><td>protein size marker&amp;nbsp;</td><td>Thermo Fisher Scientific</td><td>26620</td><td></td></tr></tbody></table>

purification and refolding to amyloid fibrils of (his)6-tagged recombinant shadoo protein expressed as inclusion bodies in e. coli

Escherichia coli sentezleme sistemi rekombinant ökariyotik proteinlerin üretimi için güçlü bir araçtır. Biz Shadoo prion familyasına ait bir proteini üretmek için kullanılır. Katma kütleleri tarif edildiği gibi (His) 6-etiketli rekombinant Shadoo saflaştırılması için bir kromatografik yöntem olarak ifade edilmiştir. Inklüzyon cisimcikleri, 8 M üre içinde çözülür ve iyon afinite kromatografisi gerçekleştirmek için bir Ni2 + -yüklü kolona bağlanmıştır. Bağlanmış proteinler imidazol gradyanı ile elüe edilir. Shadoo proteinini ihtiva eden fraksiyonlar bir yüksek ölçüde saflaştırılmış proteini elde etmek üzere boyut çıkarma kromatografisine tabi tutulur. Son adım saflaştırılmış Shadoo tuzlar, üre ve imidazol kaldırmak için HCl. Rekombinant Shadoo proteini prion hastalıklarda ortaya çıkan protein konformasyon bozukluklarının biyofiziksel ve biyokimyasal çalışmalar için önemli bir reaktiftir. Birçok rapor prion nörodejeneratif hastalıklar bıçak birikimi kaynaklı olduğunu gösterdile, amiloid fibrilleri emretti. Asidik ve nötr olarak amiloid fibrilleri içine Shadoo fibrillate açıklayan örnek protokoller / temel pHs sunulmuştur. Üretilmesi ve bir hızlı ve düşük maliyetli bir şekilde proteinin büyük miktarlarda üretilmesine imkan verir çünkü Shadoo, prion hastalıkları üzerinde çalışan laboratuarlarında araştırma kolaylaştırabilir liflenme ile ilgili yöntemler.

Saflaştınldı Shadoo proteinin yaklaşık 5-10 mg bakteri kültürü litresinde elde edilir. Bir iki-aşamalı saflaştırma yüksek saflıkta rekombinant Shadoo elde etmek için gereklidir. İlk adım, His-etiketli-proteinleri muhafaza eden bir Ni 2+ -yüklü kolon ile afinite kromatografisi ile gerçekleştirilir. Elüsyona uğratılan kısımlar SDS-PAGE tabi tutulur ve Coomassie Brilliant Blue (Şekil 5A) ile boyanır. Shadoo proteini ihtiva eden fraksiyonlar bir araya toplanmış ve da...

Watch this Scientific Journal Video about Purification and Refolding to Amyloid Fibrils of His6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli at JoVE.com

Purification and Refolding to Amyloid Fibrils of His6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli

A two-step chromatographic method is described for the purification of recombinant Shadoo protein expressed as inclusion bodies in Escherichia coli, as well as a protocol to fibrillate purified Shadoo into amyloid structures.

Saflaştırma ve Amiloid fibrillerin kadar yeniden katlama (His)<sub&gt; 6</sub&gt; etiketli Rekombinant Shadoo Protein Eklenmesi Organları olarak ifade<em&gt; E.coli</em

The Escherichia coli expression system is a powerful tool for the production of recombinant eukaryotic proteins. We use it to produce Shadoo, a protein ...

purification-refolding-to-amyloid-fibrils-his-6-tagged-recombinant

Research

JoVE Journal

Biology

Purification and Refolding to Amyloid Fibrils of (His)6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli

14.1K Görüntüleme.  INRA. A two-step chromatographic method is described for the purification of recombinant Shadoo protein expressed as inclusion bodies in Escherichia coli, as well as a protocol to fibrillate purified Shadoo into amyloid structures. 

Video: Purification and Refolding to Amyloid Fibrils of His6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli

High Precision FRET at Single-molecule Level for Biomolecule Structure Determination

A protocol on how to perform high-precision interdye distance measurements using F&#246;rster resonance energy transfer (FRET) at the single-molecule level in multiparameter fluorescence detection (MFD) mode is presented here. MFD maximizes the usage of all &#34;dimensions&#34; of fluorescence to reduce photophysical and experimental artifacts and allows for the measurement of interdye distance with an accuracy up to ~1 &#197; in rigid biomolecules. This method was used to identify three conformational states of the ligand-binding domain of the N-methyl-D-aspartate (NMDA) receptor to explain the activation of the receptor upon ligand binding. When comparing the known crystallographic structures with experimental measurements, they agreed within less than 3 &#197; for more dynamic biomolecules. Gathering a set of distance restraints that covers the entire dimensionality of the biomolecules would make it possible to provide a structural model of dynamic biomolecules.

A protocol for high-precision FRET experiments at the single molecule level is presented here. Additionally, this methodology can be used to identify three conformational states in the ligand-binding domain of the N-methyl-D-aspartate (NMDA) receptor. Determining precise distances is the first step towards building structural models based on FRET experiments.

Biyomolekül Yapısının Belirlenmesi İçin Tek Molekül Seviyesinde Yüksek Hassasiyetteki FRET

A protocol on how to perform high-precision interdye distance measurements using F&#246;rster resonance energy transfer (FRET) at the single-molecule ...

Biyokimya

From Constructs to Crystals &#8211; Towards Structure Determination of &#946;-barrel Outer Membrane Proteins

Membrane proteins serve important functions in cells such as nutrient transport, motility, signaling, survival and virulence, yet constitute only ~1% percent of known structures. There are two types of membrane proteins, &#945;-helical and &#946;-barrel. While &#945;-helical membrane proteins can be found in nearly all cellular membranes, &#946;-barrel membrane proteins can only be found in the outer membranes of mitochondria, chloroplasts, and Gram-negative bacteria. One common bottleneck in structural studies of membrane proteins in general is getting enough pure sample for analysis. In hopes of assisting those interested in solving the structure of their favorite &#946;-barrel outer membrane protein (OMP), general protocols are presented for the production of target &#946;-barrel OMPs at levels useful for structure determination by either X-ray crystallography and/or NMR spectroscopy. Here, we outline construct design for both native expression and for expression into inclusion bodies, purification using an affinity tag, and crystallization using detergent screening, bicelle, and lipidic cubic phase techniques. These protocols have been tested and found to work for most OMPs from Gram-negative bacteria; however, there are some targets, particularly for mitochondria and chloroplasts that may require other methods for expression and purification. As such, the methods here should be applicable for most projects that involve OMPs from Gram-negative bacteria, yet the expression levels and amount of purified sample will vary depending on the target OMP.

&#946;-barrel outer membrane proteins (OMPs) serve many functions within the outer membranes of Gram-negative bacteria, mitochondria, and chloroplasts. Here, we hope to alleviate a known bottleneck in structural studies by presenting protocols for the production of &#946;-barrel OMPs in sufficient quantities for structure determination by X-ray crystallography or NMR spectroscopy.

β-varil Dış Membran Proteinleri Yapı Tayini Doğru - Yapıların itibaren Crystals

Membrane proteins serve important functions in cells such as nutrient transport, motility, signaling, survival and virulence, yet constitute only ~1% ...

Kimya

Method for Efficient Refolding and Purification of Chemoreceptor Ligand Binding Domain

Identification of natural ligands of chemoreceptors and structural studies aimed at elucidation of the molecular basis of the ligand specificity can be greatly facilitated by the production of milligram amounts of pure, folded ligand binding domains. Attempts to heterologously express periplasmic ligand binding domains of bacterial chemoreceptors in Escherichia coli (E. coli) often result in their targeting into inclusion bodies. Here, a method is presented for protein recovery from inclusion bodies, its refolding and purification, using the periplasmic dCACHE ligand binding domain of Campylobacter jejuni (C. jejuni) chemoreceptor Tlp3 as an example. The approach involves expression of the protein of interest with a cleavable His6-tag, isolation and urea-mediated solubilisation of inclusion bodies, protein refolding by urea depletion, and purification by means of affinity chromatography, followed by tag removal and size-exclusion chromatography. The circular dichroism spectroscopy is used to confirm the folded state of the pure protein. It has been demonstrated that this protocol is generally useful for production of milligram amounts of dCACHE periplasmic ligand binding domains of other bacterial chemoreceptors in a soluble and crystallisable form.

A procedure is presented for the refolding of the dCACHE periplasmic ligand binding domain of Campylobacter jejuni chemoreceptor Tlp3 from inclusion bodies and the purification to yield milligram quantities of protein.

Verimli Refolding ve arıtma Chemoreceptor Ligand bağlayıcı etki için yöntemi

Identification of natural ligands of chemoreceptors and structural studies aimed at elucidation of the molecular basis of the ligand specificity can be ...

Purification and Aggregation of the Amyloid Precursor Protein Intracellular Domain

Amyloid precursor protein (APP) is a type I transmembrane protein associated with the pathogenesis of Alzheimer's disease (AD). APP is characterized by a large extracellular domain and a short cytosolic domain termed the APP intracellular domain (AICD). During maturation through the secretory pathway, APP can be cleaved by proteases termed &alpha;, &beta;, and &gamma;-secretases1. Sequential proteolytic cleavage of APP with &beta; and &gamma;-secretases leads to the production of a small proteolytic peptide, termed A&beta;, which is amyloidogenic and the core constituent of senile plaques. The AICD is also liberated from the membrane after secretase processing, and through interactions with Fe65 and Tip60, can translocate to the nucleus to participate in transcription regulation of multiple target genes2,3. Protein-protein interactions involving the AICD may affect trafficking, processing, and cellular functions of holo-APP and its C-terminal fragments. We have recently shown that AICD can aggregate in vitro, and this process is inhibited by the AD-implicated molecular chaperone ubiquilin-14. Consistent with these findings, the AICD has exposed hydrophobic domains and is intrinsically disordered in vitro5,6, however it obtains stable secondary structure when bound to Fe657. We have proposed that ubiquilin-1 prevents inappropriate inter- and intramolecular interactions of AICD, preventing aggregation in vitro and in intact cells4. While most studies focus on the role of APP in the pathogenesis of AD, the role of AICD in this process is not clear. Expression of AICD has been shown to induce apoptosis8, to modulate signaling pathways9, and to regulate calcium signaling10. Over-expression of AICD and Fe65 in a transgenic mouse model induces Alzheimer's like pathology11, and recently AICD has been detected in brain lysates by western blotting when using appropriate antigen retrieval techniques12. To facilitate structural, biochemical, and biophysical studies of the AICD, we have developed a procedure to produce recombinantly large amounts of highly pure AICD protein. We further describe a method for inducing the in vitro thermal aggregation of AICD and analysis by atomic force microscopy. The methods described are useful for biochemical, biophysical, and structural characterization of the AICD and the effects of molecular chaperones on AICD aggregation.

A method for large-scale purification of the APP intracellular domain (AICD) is described. We also describe methodology to induce in vitro AICD aggregation and visualization by atomic force microscopy. The methods described are useful for biochemical/structural characterization of the AICD and the effects of molecular chaperones on its aggregation.

Amiloid prekürsör protein intrasellüler Domain saflaştırılması ve toplama

Amyloid precursor protein (APP) is a type I transmembrane protein associated with the pathogenesis of Alzheimer's disease (AD). APP is characterized by a ...

Tıp

Synthesis of an Intein-mediated Artificial Protein Hydrogel

We present the synthesis of a highly stable protein hydrogel mediated by a split-intein-catalyzed protein trans-splicing reaction. The building blocks of this hydrogel are two protein block-copolymers each containing a subunit of a trimeric protein that serves as a crosslinker and one half of a split intein. A highly hydrophilic random coil is inserted into one of the block-copolymers for water retention. Mixing of the two protein block copolymers triggers an intein trans-splicing reaction, yielding a polypeptide unit with crosslinkers at either end that rapidly self-assembles into a hydrogel. This hydrogel is very stable under both acidic and basic conditions, at temperatures up to 50 &#176;C, and in organic solvents. The hydrogel rapidly reforms after shear-induced rupture. Incorporation of a &#34;docking station peptide&#34; into the hydrogel building block enables convenient incorporation of &#34;docking protein&#34;-tagged target proteins. The hydrogel is compatible with tissue culture growth media, supports the diffusion of 20 kDa molecules, and enables the immobilization of bioactive globular proteins. The application of the intein-mediated protein hydrogel as an organic-solvent-compatible biocatalyst was demonstrated by encapsulating the horseradish peroxidase enzyme and corroborating its activity.

We present the synthesis of a split-intein-mediated protein hydrogel. The building blocks of this hydrogel are two protein copolymers each containing a subunit of a trimeric protein that serves as a crosslinker and one half of a split intein. Mixing of the two protein copolymers triggers an intein trans-splicing reaction, yielding a polypeptide unit that self-assembles into a hydrogel. This hydrogel is highly pH- and temperature-stable, compatible with organic solvents, and easily incorporates functional globular proteins.

Bir Intein aracılı yapay protein Hidrojel sentezi

We present the synthesis of a highly stable protein hydrogel mediated by a split-intein-catalyzed protein trans-splicing reaction. The building blocks of ...

Biyomühendislik

Expression, Purification, Crystallization, and Enzyme Assays of Fumarylacetoacetate Hydrolase Domain-Containing Proteins

Fumarylacetoacetate hydrolase (FAH) domain-containing proteins (FAHD) are identified members of the FAH superfamily in eukaryotes. Enzymes of this superfamily generally display multi-functionality, involving mainly hydrolase and decarboxylase mechanisms. This article presents a series of consecutive methods for the expression and purification of FAHD proteins, mainly FAHD protein 1 (FAHD1) orthologues among species (human, mouse, nematodes, plants, etc.). Covered methods are protein expression in E. coli, affinity chromatography, ion exchange chromatography, preparative and analytical gel filtration, crystallization, X-ray diffraction, and photometric assays. Concentrated protein of high levels of purity (&#62;98%) may be employed for crystallization or antibody production. Proteins of similar or lower quality may be employed in enzyme assays or used as antigens in detection systems (Western-Blot, ELISA). In the discussion of this work, the identified enzymatic mechanisms of FAHD1 are outlined to describe its hydrolase and decarboxylase bi-functionality in more detail.

Expression and purification of fumarylacetoacetate hydrolase domain-containing proteins is described with examples (expression in E. coli, FPLC). Purified proteins are used for crystallization and antibody production and employed for enzyme assays. Selected photometric assays are presented to display the multi-functionality of FAHD1 as oxaloacetate decarboxylase and acylpyruvate hydrolase.

Fumarylacetoasetat Hydrolase etki alanı Içeren proteinleri ifade, arıtma, kristalizasyon ve enzim Asdimleri

Fumarylacetoacetate hydrolase (FAH) domain-containing proteins (FAHD) are identified members of the FAH superfamily in eukaryotes. Enzymes of this ...

Targeting Cysteine Thiols for in Vitro Site-specific Glycosylation of Recombinant Proteins

Stromal interaction molecule-1 (STIM1) is a type-I transmembrane protein located on the endoplasmic reticulum (ER) and plasma membranes (PM). ER-resident STIM1 regulates the activity of PM Orai1 channels in a process known as store operated calcium (Ca2+) entry which is the principal Ca2+ signaling process that drives the immune response. STIM1 undergoes post-translational N-glycosylation at two luminal Asn sites within the Ca2+ sensing domain of the molecule. However, the biochemical, biophysical, and structure biological effects of N-glycosylated STIM1 were poorly understood until recently due to an inability to readily obtain high levels of homogeneous N-glycosylated protein. Here, we describe the implementation of an in vitro chemical approach which attaches glucose moieties to specific protein sites applicable to understanding the underlying effects of N-glycosylation on protein structure and mechanism. Using solution nuclear magnetic resonance spectroscopy we assess both efficiency of the modification as well as the structural consequences of the glucose attachment with a single sample. This approach can readily be adapted to study the myriad glycosylated proteins found in nature.

Targeting Cysteine Thiols for in Vitro Site-specific Glycosylation of Recombinant Proteins

Biochemical and structural analyses of glycosylated proteins require relatively large amounts of homogeneous samples. Here, we present an efficient chemical method for site-specific glycosylation of recombinant proteins purified from bacteria by targeting reactive Cys thiols.

Sistein Thiols rekombinant proteinler Vitro siteye özgü Glikozilasyon için hedefleme

Stromal interaction molecule-1 (STIM1) is a type-I transmembrane protein located on the endoplasmic reticulum (ER) and plasma membranes (PM). ER-resident ...

İmmünoloji ve Enfeksiyon

Purification of Hsp104, a Protein Disaggregase

Hsp104 is a hexameric AAA+ protein1 from yeast, which couples ATP hydrolysis to protein disaggregation2-10 (Fig. 1). This activity imparts two key selective advantages. First, renaturation of disordered aggregates by Hsp104 empowers yeast survival after various protein-misfolding stresses, including heat shock3,5,11,12. Second, remodeling of cross-beta amyloid fibrils by Hsp104 enables yeast to exploit myriad prions (infectious amyloids) as a reservoir of beneficial and heritable phenotypic variation13-22. Remarkably, Hsp104 directly remodels preamyloid oligomers and amyloid fibrils, including those comprised of the yeast prion proteins Sup35 and Ure223-30. This amyloid-remodeling functionality is a specialized facet of yeast Hsp104. The E. coli orthologue, ClpB, fails to remodel preamyloid oligomers or amyloid fibrils26,31,32.
Hsp104 orthologues are found in all kingdoms of life except, perplexingly, animals. Indeed, whether animal cells possess any enzymatic system that couples protein disaggregation to renaturation (rather than degradation) remains unknown33-35. Thus, we and others have proposed that Hsp104 might be developed as a therapeutic agent for various neurodegenerative diseases connected with the misfolding of specific proteins into toxic preamyloid oligomers and amyloid fibrils4,7,23,36-38. There are no treatments that directly target the aggregated species associated with these diseases. Yet, Hsp104 dissolves toxic oligomers and amyloid fibrils composed of alpha-synuclein, which are connected with Parkinson's Disease23 as well as amyloid forms of PrP39. Importantly, Hsp104 reduces protein aggregation and ameliorates neurodegeneration in rodent models of Parkinson's Disease23 and Huntington's disease38. Ideally, to optimize therapy and minimize side effects, Hsp104 would be engineered and potentiated to selectively remodel specific aggregates central to the disease in question4,7. However, the limited structural and mechanistic understanding of how Hsp104 disaggregates such a diverse repertoire of aggregated structures and unrelated proteins frustrates these endeavors30,40-42.
To understand the structure and mechanism of Hsp104, it is essential to study the pure protein and reconstitute its disaggregase activity with minimal components. Hsp104 is a 102kDa protein with a pI of ~5.3, which hexamerizes in the presence of ADP or ATP, or at high protein concentrations in the absence of nucleotide43-46. Here, we describe an optimized protocol for the purification of highly active, stable Hsp104 from E. coli. The use of E. coli allows simplified large-scale production and our method can be performed quickly and reliably for numerous Hsp104 variants. Our protocol increases Hsp104 purity and simplifies His6-tag removal compared to a previous purification method from E. coli47. Moreover, our protocol is more facile and convenient than two more recent protocols26,48.

Here, we describe a protocol for the purification of highly active Hsp104, a hexameric AAA+ protein from yeast, which couples ATP hydrolysis to protein disaggregation. This scheme exploits a His6-tagged construct for affinity purification from E. coli followed by anion-exchange chromatography, His6-tag removal with TEV protease, and size-exclusion chromatography.

Hsp104 saflaştırılması, Protein Disaggregase

Hsp104 is a hexameric AAA+ protein1 from yeast, which couples ATP hydrolysis to protein disaggregation2-10 (Fig. 1). This activity imparts two key ...

Biyoloji

Production of E. coli-expressed Self-Assembling Protein Nanoparticles for Vaccines Requiring Trimeric Epitope Presentation

Self-assembling protein nanoparticles (SAPNs) function as repetitive antigen displays and can be used to develop a wide range of vaccines for different infectious diseases. In this article we demonstrate a method to produce a SAPN core containing a six-helix bundle (SHB) assembly that is capable of presenting antigens in a trimeric conformation. We describe the expression of the SHB-SAPN in an E. coli system, as well as the necessary protein purification steps. We included an isopropanol wash step to reduce the residual bacterial lipopolysaccharide. As an indication of the protein identity and purity, the protein reacted with known monoclonal antibodies in Western blot analyses. After refolding, the size of the particles fell in the expected range (20 to 100 nm), which was confirmed by dynamic light scattering, nanoparticle tracking analysis, and transmission electron microscopy. The methodology described here is optimized for the SHB-SAPN, however, with only slight modifications it can be applied to other SAPN constructs. This method is also easily transferable to large scale production for GMP manufacturing for human vaccines.

Production of E. coli-expressed Self-Assembling Protein Nanoparticles for Vaccines Requiring Trimeric Epitope Presentation

A detailed method is provided here describing the purification, refolding, and characterization of self-assembling protein nanoparticles (SAPNs) for use in vaccine development.

Trimerik Epitop Sunumu Gerektiren Aşılar için E. coli-expressed Self-Assembling Protein Nano tanecikleri Üretimi

Self-assembling protein nanoparticles (SAPNs) function as repetitive antigen displays and can be used to develop a wide range of vaccines for different ...

Rapid Generation of Amyloid from Native Proteins In vitro

Proteins carry out crucial tasks in organisms by exerting functions elicited from their specific three dimensional folds. Although the native structures of polypeptides fulfill many purposes, it is now recognized that most proteins can adopt an alternative assembly of beta-sheet rich amyloid. Insoluble amyloid fibrils are initially associated with multiple human ailments, but they are increasingly shown as functional players participating in various important cellular processes. In addition, amyloid deposited in patient tissues contains nonproteinaceous components, such as nucleic acids and glycosaminoglycans (GAGs). These cofactors can facilitate the formation of amyloid, resulting in the generation of different types of insoluble precipitates. By taking advantage of our understanding how proteins misfold via an intermediate stage of soluble amyloid precursor, we have devised a method to convert native proteins to amyloid fibrils in vitro. This approach allows one to prepare amyloid in large quantities, examine the properties of amyloid generated from specific proteins, and evaluate the structural changes accompanying the conversion.

Rapid Generation of Amyloid from Native Proteins In vitro

Proteins can either adopt a native structure or misfold into insoluble amyloid. Conditions that favor the misfolding pathway lead to the formation of different types of amyloid fibrils. The methods described here allow rapid conversion of native proteins into amyloid in vitro.

Proteins carry out crucial tasks in organisms by exerting functions elicited from their specific three dimensional folds. Although the native structures ...

Saflaştırma ve Amiloid fibrillerin kadar yeniden katlama (His)

Özet

Daha Fazla Video Keşfet

Bu videodaki bölümler

Biyomolekül Yapısının Belirlenmesi İçin Tek Molekül Seviyesinde Yüksek Hassasiyetteki FRET

β-varil Dış Membran Proteinleri Yapı Tayini Doğru - Yapıların itibaren Crystals

Verimli Refolding ve arıtma Chemoreceptor Ligand bağlayıcı etki için yöntemi

Amiloid prekürsör protein intrasellüler Domain saflaştırılması ve toplama

Bir Intein aracılı yapay protein Hidrojel sentezi

Fumarylacetoasetat Hydrolase etki alanı Içeren proteinleri ifade, arıtma, kristalizasyon ve enzim Asdimleri

Sistein Thiols rekombinant proteinler Vitro siteye özgü Glikozilasyon için hedefleme

Hsp104 saflaştırılması, Protein Disaggregase

Trimerik Epitop Sunumu Gerektiren Aşılar için E. coli-expressed Self-Assembling Protein Nano tanecikleri Üretimi

Rapid Generation of Amyloid from Native Proteins In vitro