The authors would like to acknowledge Natalie Doude and David Westerway (University of Alberta) for providing us Sho cDNA, Christophe Chevalier (INRA) for plasmid construction, Michel Br&#233;mont (INRA) for providing us BL21Sol bacteria; Christine Longin (INRA) for TEM assistance and Edith Pajot-Augy (INRA) for comments and proofreading.

1. דור של ביטוי פלסמיד וShadoo הערה: חלבון Shadoo עכברי גן המקודד (Shadoo 25-122), היה subcloned לתוך וקטור ביטוי PET-28 11. שיבוט זה הפך לE. coli SoluBL21 זן חיידקים, להביע חלבון Shadoo עם תג N-מסוף hexahistidine, (HHHHHHHHHHSSGHIDDDDKHMKGGRGGARGSARGVRGGARGASRVRVRP APRYGSSLRVAAAGAAAGAAAGVAAGLATGSGWRRTSGPGELGLEDDENGAMGGNGTDRGVYSYWAWTSG) כפי שהוסבר בעבר 11. פלסמיד ניתן לבקש מהמחברים. המשקל המולקולרי של Shadoo מחושב מרצף חומצות אמינו שלה הוא 12,243.2 Da. הערה: בצע את כל המניפולציות עם חיידקים מתחת למכסת מנוע לזרום laminal או קרובה ללהבה בונזן. <ol style=";text-align:right;direction:rtl"><li style=";text-align:right;direction:rtl"> להפוך חיידקי SoluBL21 המוסמכים עם PET-28-פלסמיד -Shadoo 6, באמצעות פרוטוקול הלם חום סטנדרטי. לשם כך לערבב 1 עד 5 μl של פלסמיד (בדרך כלל 10 עמ &#39;100ng) לתוך 50 μl של החיידקים בצינור. בצע את הלם החום על 42 מעלות צלזיוס למשך 45 שניות. </li><li style=";text-align:right;direction:rtl"> תרבות הפכה חיידקים על 37 מעלות צלזיוס עד 600 של 0.5-0.7 במדיום לוריא-Bertani בתוספת 40 מ&quot;ג / מיליליטר kanamycin (איור 1). </li><li style=";text-align:right;direction:rtl"> לגרום O ביטוי Shadoo / N על ידי הוספת 240 מיקרוגרם איזופרופיל-β-D-thiogalactopyranoside / מיליליטר, ITPG, לתרבות. חיידקי תרבות תחת הרועד בסל&quot;ד 150 על 37 מעלות צלזיוס. הערה: בדרך כלל, תרבות חיידקים מגיעה 600 של 3 O / N. ניתן לאחסן חיידקים שינה ב -80 ° C לייצור חלבון עתיד: הערה. לשם כך, להוסיף 10% -50% (V / V) גליצרול סטרילי לaliquots תרבות חיידקים ולהקפיא אותם ב -80 ° C. </li></ol><img alt="איור 1" src="/files/ftp_upload/53432/53432fig1.jpg" /> תכנית איור 1. מבנה של ביטוי, שינוי Shadoo חיידקים ואינדוקציה של ביטוי Shadoo (כמתואר בשלב 1). </strong&gt; () מבנה הביטוי לShadoo מקודד תג hexahistidine התמזג N-הסופית של החלבון, NT. התכנית מראה כי חלבון Shadoo מכיל חזרות בסיסיות ארגינין / גליצין (גליל ירוק), תחום הידרופובי (HD), ואתר יחיד N-glycosylation (CHO), ואחריו C-סופית (CT). PET-28-6 -Shadoo פלסמיד (B) הופך לחיידקי SoluBL21 על ידי הלם חום במשך 45 שניות על 42 מעלות צלזיוס. חיידקים הפכו הם מצופים על אגר סלקטיבי המכיל 40 מיקרוגרם / מיליליטר kanamycin. מושבה אחת מהצלחת משמשת לחסן תרבות בבקבוק שייקר 1,000-3,000 מיליליטר. ביטוי של חלבון רקומביננטי מושרה עם IPTG 1 מ&quot;מ. <a href="https://www.jove.com/files/ftp_upload/53432/53432fig1highres.jpg" target="_blank">אנא לחץ כאן כדי לצפות בגרסה גדולה יותר של דמות זו.</a> 2. טיהור של חלבון Shadoo ידי כרומטוגרפיה נוזלית בלחץ נמוך (LPLC) <ol style=";text-align:right;direction:rtl"><li style=";text-align:right;direction:rtl"> תמוגה תא ובהכנת גופי clusion <ol style=";text-align:right;direction:rtl"><li style=";text-align:right;direction:rtl"> אסוף את ההשעיה החיידקים ולהעביר אותו לתוך צינורות צנטריפוגה (איור 2). </li><li style=";text-align:right;direction:rtl"> ספין ב2,500 XG, במשך 20 דקות ב 4 מעלות צלזיוס. הסר supernatant באמצעות אחסון וכדורים גלולים ב 15 מיליליטר חיץ (50 מ&quot;מ טריס, 10 mM EDTA, pH 8 עם קוקטייל אנטי-פרוטאז) לכל גלולה הנגזרת מ500 מיליליטר של תרבית תאים. הערה: אפשר להקפיא כדורי Resuspended ומאוחסנים ב -20 ° C במשך כמה ימים. הקפאה מאפשרת תמוגה תאי חיידקים. </li><li style=";text-align:right;direction:rtl"> בדוק את ביטוי היתר של חלבון רקומביננטי באמצעות כדורי חיידקים גולמיים על ידי ניתוח SDS-PAGE וצביעת Coomassie. <ol style=";text-align:right;direction:rtl"><li style=";text-align:right;direction:rtl"> לשם כך, מיליליטר צנטריפוגות 1 של תרבות חיידקים לגלולת תאים. הוספת 100 פתרון μl Laemmli denaturation (277.8 מ&quot;מ טריס-HCl, pH 6.8, 4.4% SDS, 44.4% w / v גליצרול, bromophenol 0.02% הכחולים) לגלולה וחום ב 100 מעלות צלזיוס למשך 5 דקות. </li><li style=";text-align:right;direction:rtl"> עומס 10 μl של המדגם לג&#39;ל acrylamide 12%, SDS-PAGE וVisu לרוץAlize מופרד חלבונים על ידי צביעת Coomassie. </li></ol></li><li style=";text-align:right;direction:rtl"> להוסיף Triton X-100 0.5% ריכוז סופי לגלולה המושעית לחלוטין מ2.1.2). </li><li style=";text-align:right;direction:rtl"> דגירה ההשעיה באמבט מים על 37 מעלות צלזיוס למשך 30 דקות. </li><li style=";text-align:right;direction:rtl"> Sonicate ההשעיה של 5 דקות ב6-12 מיקרון משרעת שיא-לשיא במים קר כקרח לlyse תאי חיידקים. </li><li style=";text-align:right;direction:rtl"> העברת sonicated השעיה לתוך 50 מיליליטר צינורות צנטריפוגה נקיים. </li><li style=";text-align:right;direction:rtl"> צינורות צנטריפוגה ב 15,000 XG במשך 15 דקות ב 4 מעלות צלזיוס. </li><li style=";text-align:right;direction:rtl"> הסר supernatant באמצעות אחסון ולהוסיף 5 מיליליטר של החיץ המחייב (20 מ&quot;מ טריס החיץ-HCl, pH 7.4, 0.5 M NaCl, 8 M אוריאה, 5 מ&quot;מ Imidazole) לכל צינור. </li><li style=";text-align:right;direction:rtl"> מקום צינורות על O גלגל / N מסתובב לresuspend לחלוטין חלבונים מגופי הכללה. </li></ol><img alt="איור 2" src="/files/ftp_upload/53432/53432fig2.jpg" /> תכנית איור 2. טיהור ההכללהגופים (כמתואר בשלב 2.1). שינה חיידקים להביע Shadoo נקצרים על ידי צנטריפוגה וresuspended במאגר תמוגה. ההשעיה היא טופחה על 37 מעלות צלזיוס למשך 30 דקות, ולאחר מכן sonicated לשבור מכאני תאי חיידקים. Sonication נעשה על קרח כדי למנוע חימום מדגם. תאים שבורים נקצרים על ידי צנטריפוגה וresuspended במאגר המכיל 8 M אוריאה לsolubilize חלבונים מגופי הכללה. <a href="https://www.jove.com/files/ftp_upload/53432/53432fig2highres.jpg" target="_blank">אנא לחץ כאן כדי לצפות בגרסה גדולה יותר של דמות זו.</a> </li><li style=";text-align:right;direction:rtl"> כרומטוגרפיה -affinity Ni 2 + הערה: כרומטוגרפיה מבוצעת על מערכת FPLC באמצעות 2 + Ni -charged, 5 מיליליטר עמודת chelating Sepharose (איור 3 א). כל הפתרונות מועמסים על העמודה עם קצב זרימה של 1 מיליליטר / דקה. <ol style=";text-align:right;direction:rtl"><li style=";text-align:right;direction:rtl"> הזרק 10 מיליליטר של 0.2 פתרון 4 מים M Niso לטור Sepharose כדי לחייב אותועם -ions 2 + Ni. </li><li style=";text-align:right;direction:rtl"> לאזן את העמודה טעונה עם -ions Ni 2 + על ידי הזרקת 30-50 מיליליטר של חיץ המחייב המכיל ריכוז נמוך של imidazole (20 מ&quot;מ טריס חיץ-HCl, pH 7.4, 0.5 M NaCl, 8 M אוריאה, 5 מ&quot;מ Imidazole). </li><li style=";text-align:right;direction:rtl"> טען את החלבונים-solubilized אוריאה עם הזרקת לולאת 50 מיליליטר. </li><li style=";text-align:right;direction:rtl"> לשחזר את חלק הזרימה דרך על ידי שטיפה יסודית הטור עם 10 מיליליטר חיץ imidazole הנמוך מחייב (20 מ&quot;מ טריס חיץ-HCl, pH 7.4, 0.5 M NaCl, 8 M אוריאה, 5 מ&quot;מ Imidazole) כדי להסיר את מקסימום של חלבונים מאוגד מהטור. </li><li style=";text-align:right;direction:rtl"> לשטוף את העמודה עם 50-100 מיליליטר של חיץ הכביסה (20 מ&quot;מ טריס-HCl, pH 7.4, 0.5 M NaCl, 8 M אוריאה, 80 מ&quot;מ imidazole) לelute חלבונים שאינם קשורים באופן ספציפי לעמודה. </li><li style=";text-align:right;direction:rtl"> החל שיפוע ליניארית 15 דקות של 80-800 מ&quot;מ Imidazole במאגר המכיל 20 מ&quot;מ טריס-HCl, pH 7.4, 0.5 M NaCl, 8 M אוריאה. לאסוף 1 מיליליטר שברים במהלך היישום ההדרגתי. הערה: מתויגים-חלבונים eluted שנינותשיפוע דונם של מאגר המכיל imidazole (המשמש כמתחרה). </li><li style=";text-align:right;direction:rtl"> קח aliquot 8 μl של כל חלק ולהוסיף פתרון denaturation 4 μl 4x Laemmli (ראה 2.1.3.1). פתרונות חום של 100 מעלות צלזיוס למשך 5 דקות. </li><li style=";text-align:right;direction:rtl"> עומס 10 μl של סמן גודל חלבון ו -10 μl של כל דגימה לג&#39;ל acrylamide 12%, SDS-PAGE לרוץ ולדמיין חלבונים מופרדים על ידי צביעת Coomassie. הערה: המשקל המולקולרי של Shadoo מחושב ליצור רצף חומצות אמינו הוא 12,243.2 Da. </li><li style=";text-align:right;direction:rtl"> בריכה כל השברים המכילים Shadoo. </li></ol><img alt="איור 3" src="/files/ftp_upload/53432/53432fig3.jpg" /> איור 3. הליך טיהור (כפי שמתואר בשלבים 2.2-2.4). יכול להיות מתואם 2 + -ions () ניקל על ידי שאריות היסטידין, המאפשרת טיהור סלקטיבית של חלבונים מתויג polyhistidine. Imidazole משמש לelute החלבון, דרךיכולתה לתאם עם -ion Ni 2 + ולעקור את החלבון הקשור. (ב) חלבונים של רדיוס הידרודינמית שונה שנשמרו בNi 2 + -column מופרדים על עמודת הדרת גודל. חלבונים eluted מהגדולים ביותר לקטן ביותר. (ג) לפני השימוש, שברים המכילים Shadoo הם אספו וdesalted להסיר אוריאה, imidazole ומלחים. מבחני בקרת איכות כוללים SDS-PAGE / הכתמת Coomassie, מערבי סופג. ניתן להקפיא-מיובש המטוהר Shadoo. Lyophilized Shadoo יציב במשך חודשים כאשר מאוחסנים ב -20 מעלות צלזיוס. <a href="https://www.jove.com/files/ftp_upload/53432/53432fig3highres.jpg" target="_blank">אנא לחץ כאן כדי לצפות בגרסה גדולה יותר של דמות זו.</a> </li><li style=";text-align:right;direction:rtl"> כרומטוגרפיה הדרת גודל הערה: צעד טיהור שני מורכב בכרומטוגרפיה הדרת גודל שמפרידה בין חלבון Shadoo מחלבונים האחרים לשתף eluted במהלך שלב הטיהור הראשון(איור 3). <ol style=";text-align:right;direction:rtl"><li style=";text-align:right;direction:rtl"> לאזן טור Superdex של 120 מיליליטר הכולל מיטה נפח ידי הזרקת 250 מיליליטר של חיץ 20 מ&quot;מ טריס-HCl, pH 7.4, 0.5 M NaCl, 8 M אוריאה בקצב הזרימה של 1.5 מיליליטר / דקה. </li><li style=";text-align:right;direction:rtl"> ברי עומס נקוו מכילים Shadoo מ2.2.9 על עמודת equilibrated. לאסוף 1 מיליליטר שברים אחרי הטור-חלל הנפח של 40 מיליליטר על הזרימה המתמדת של המאגר לעיל. </li><li style=";text-align:right;direction:rtl"> קח aliquot 10 μl של כל חלק ולבצע ניתוח SDS-PAGE וצביעת Coomassie כפי שתואר לעיל כדי לגלות שברים להכיל Shadoo. </li><li style=";text-align:right;direction:rtl"> שברים בריכה המכילים Shadoo. </li></ol></li><li style=";text-align:right;direction:rtl"> Desalting הערה: הליך desalting מסיר מלחים, imidazole ואוריאה להשיג חלבון Shadoo רקומביננטי במאגר מתאים למחקרים נוספים biophysical וביוכימיים (איור 3 ג). ניתן להשיג אותה התוצאה על ידי dialyzing דגימות נגד המאגר. <ol style=";text-align:right;direction:rtl"><li style=";text-align:right;direction:rtl"> לאזן טור desalting של 53 מיליליטר עם 150 מיליליטרשל חיץ 10 מ&quot;מ אמוניום אצטט, pH 5, בקצב זרימה של 5 מיליליטר / דקה. </li><li style=";text-align:right;direction:rtl"> עומס אספו שברים Shadoo על העמודה. עם ההזרקה של חיץ אמוניום אצטט לאסוף ידני שברים שמצביעים על עלייה של האות ב 280 ננומטר במוצא של גלאי UV. </li><li style=";text-align:right;direction:rtl"> להקפיא-ייבוש Shadoo desalted ולאחסן אותו ב -20 מעלות צלזיוס. </li><li style=";text-align:right;direction:rtl"> ממיסים Shadoo lyophilized בחיץ הולם, כגון 10 חיץ נתרן אצטט מ&quot;מ, pH 5, לפני שימוש. הערה: תג polyhistidine ניתן להסיר עם enterokinase. </li></ol></li></ol> 3. במבחנה הרכבה של Shadoo לעמילואיד סיבים בפיזיולוגי pH הערה: אגרגטים חלבון Shadoo וספונטני יוצרים סיבים ב- pH ≥ 7 11. <img alt="איור 4" src="/files/ftp_upload/53432/53432fig4.jpg" /> איור 4. תכנית של Shadoo מקפל לסיבי עמילואיד (כdescriהמיטה בשלב 3). מזוקק Shadoo ספונטנית ממירה לסיבי עמילואיד כאשר מומסים במאגר של ≥ pH 7. בתמיסה חומצית, Shadoo ממיר לסיבי עמילואיד על דגירה עם 1 M GDN-HCl תוך רעד. מבחני בקרת איכות כוללים מיקרוסקופיה אלקטרונית וצביעת tht. <a href="https://www.jove.com/files/ftp_upload/53432/53432fig4highres.jpg" target="_blank">אנא לחץ כאן כדי לצפות בגרסה גדולה יותר של דמות זו.</a> <ol style=";text-align:right;direction:rtl"><li style=";text-align:right;direction:rtl"> לדלל Shadoo לריכוז סופי של 2 מיקרומטר במאגר 20 מ&quot;מ טריס- HCl, pH 7.4. למדוד את הריכוז על ידי מדידת הצפיפות האופטית של הפתרון ב 280 ננומטר ובאמצעות מקדם ההכחדה להסיק מרכב חומצות אמינו Shadoo של 20970. </li><li style=";text-align:right;direction:rtl"> דגירה 500 μl של הפתרון בצינור פלסטיק חרוטי על 4 מעלות צלזיוס במשך כמה שבועות, כדי לאפשר המרת חלבון ספונטנית למבני עמילואיד (איור 4). </li><li style=";text-align:right;direction:rtl"> הוסף מוכן טרי thioflavin T (THT) לconce סופיntration של 10 מיקרומטר לaliquot 100 μl של פתרון Shadoo. דגירה הפתרון למשך 5 דקות על RT. למדוד פליטת הקרינה 460-520 ננומטר באמצעות גל עירור של 435 ננומטר כדי לאמת את נוכחותם של מבני עמילואיד 17. </li></ol> 4. במבחנה הרכבה של Shadoo לעמילואיד סיבים בחומציים PHS <ol style=";text-align:right;direction:rtl"><li style=";text-align:right;direction:rtl"> לדלל Shadoo ב 1 M GdnHCl, חיץ 20 מ&quot;מ Na-אצטט, pH 5 לריכוז סופי של 2 מיקרומטר. </li><li style=";text-align:right;direction:rtl"> דגירה 500 μl של פתרון זה בצינור חרוטי עם רעד מתמשך על 37 מעלות צלזיוס, ל3-7 ימים. </li><li style=";text-align:right;direction:rtl"> לבדוק הנוכחות של סיבי עמילואיד על ידי הוספת tht לaliquot של הפתרון כמו ב3.3. </li><li style=";text-align:right;direction:rtl"> Dialyze השעיה התקבלה נגד 10 חיץ מ&quot;מ Na-אצטט, pH 5.0, לטהר סיבי עמילואיד Shadoo. </li><li style=";text-align:right;direction:rtl"> אחסן סיבים מטוהרים ב+4 מעלות צלזיוס. </li></ol><img alt="איור 5" src="/files/ftp_upload/53432/53432fig5.jpg"/&gt; איור 5. נציגי תוצאות. שברי חלבון eluted מNi 2 + -charged עמודת chelating () ועמודה הדרת גודל (ב &#39;) נותחו באמצעות SDS-PAGE וצביעת Coomassie. זיהוי של Shadoo המטוהר הוערך באמצעות נוגדן SPRN אנטי Shadoo (C). <a href="https://www.jove.com/files/ftp_upload/53432/53432fig5large.jpg" target="_blank">אנא לחץ כאן כדי לצפות בגרסה גדולה יותר של דמות זו.</a>

<ol>
	<li>Biasini, E., Turnbaugh, J. A., Unterberger, U., Harris, D. A. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Prion+protein+at+the+crossroads+of+physiology+and+disease.">Prion protein at the crossroads of physiology and disease.</a> Trends in Neurosciences. 35, 92-103 (2012).</li><li>Colby, D. W., Prusiner, S. B. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=De+novo+generation+of+prion+strains.">De novo generation of prion strains.</a> Nature Reviews. Microbiology. 9, 771-777 (2011).</li><li>Chiti, F., Dobson, C. M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Protein+misfolding,+functional+amyloid,+and+human+disease.">Protein misfolding, functional amyloid, and human disease.</a> Annual Review of Biochemistry. 75, 333-366 (2006).</li><li>Nelson, R., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Structure+of+the+cross-beta+spine+of+amyloid-like+fibrils.">Structure of the cross-beta spine of amyloid-like fibrils.</a> Nature. 435, 773-778 (2005).</li><li>Murphy, R. M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Kinetics+of+amyloid+formation+and+membrane+interaction+with+amyloidogenic+proteins.">Kinetics of amyloid formation and membrane interaction with amyloidogenic proteins.</a> Biochimica et Biophysica Acta. 1768, 1923-1934 (2007).</li><li>Steunou, S., Chich, J. F., Rezaei, H., Vidic, J. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Biosensing+of+lipid-prion+interactions:+insights+on+charge+effect,+Cu(II)-ions+binding+and+prion+oligomerization.">Biosensing of lipid-prion interactions: insights on charge effect, Cu(II)-ions binding and prion oligomerization.</a> Biosensors &amp; Bioelectronics. 26, 1399-1406 (2010).</li><li>Watts, J. C., Westaway, D. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+prion+protein+family:+diversity,+rivalry,+and+dysfunction.">The prion protein family: diversity, rivalry, and dysfunction.</a> Biochimica et Biophysica Acta. 1772, 654-672 (2007).</li><li>Westaway, D., Daude, N., Wohlgemuth, S., Harrison, P. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+PrP-like+proteins+Shadoo+and+Doppel.">The PrP-like proteins Shadoo and Doppel.</a> Topics in Current Chemistry. 305, 225-256 (2011).</li><li>Baillod, P., Garrec, J., Tavernelli, I., Rothlisberger, U. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Prion+versus+doppel+protein+misfolding:+new+insights+from+replica-exchange+molecular+dynamics+simulations.">Prion versus doppel protein misfolding: new insights from replica-exchange molecular dynamics simulations.</a> Biochemistry. 52, 8518-8526 (2013).</li><li>Daude, N., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Wild-type+Shadoo+proteins+convert+to+amyloid-like+forms+under+native+conditions.">Wild-type Shadoo proteins convert to amyloid-like forms under native conditions.</a> Journal of Neurochemistry. 113, 92-104 (2010).</li><li>Li, Q., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Shadoo+binds+lipid+membranes+and+undergoes+aggregation+and+fibrillization.">Shadoo binds lipid membranes and undergoes aggregation and fibrillization.</a> Biochemical and Biophysical Research Communications. 438, 519-525 (2013).</li><li>Watts, J. C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+CNS+glycoprotein+Shadoo+has+PrP(C)-like+protective+properties+and+displays+reduced+levels+in+prion+infections.">The CNS glycoprotein Shadoo has PrP(C)-like protective properties and displays reduced levels in prion infections.</a> The EMBO Journal. 26, 4038-4050 (2007).</li><li>Watts, J. C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Protease-resistant+prions+selectively+decrease+Shadoo+protein.">Protease-resistant prions selectively decrease Shadoo protein.</a> PLoS Pathogens. 7, e1002382 (2011).</li><li>Westaway, D., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Down-regulation+of+Shadoo+in+prion+infections+traces+a+pre-clinical+event+inversely+related+to+PrP(Sc)+accumulation.">Down-regulation of Shadoo in prion infections traces a pre-clinical event inversely related to PrP(Sc) accumulation.</a> PLoS Pathogens. 7, e1002391 (2011).</li><li>Chevalier, C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=PB1-F2+influenza+A+virus+protein+adopts+a+beta-sheet+conformation+and+forms+amyloid+fibers+in+membrane+environments.">PB1-F2 influenza A virus protein adopts a beta-sheet conformation and forms amyloid fibers in membrane environments.</a> The Journal of Biological Chemistry. 285, 13233-13243 (2010).</li><li>Tarus, B., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Oligomerization+paths+of+the+nucleoprotein+of+influenza+A+virus.">Oligomerization paths of the nucleoprotein of influenza A virus.</a> Biochimie. 94, 776-785 (2012).</li><li>Biancalana, M., Koide, S. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Molecular+mechanism+of+Thioflavin-T+binding+to+amyloid+fibrils.">Molecular mechanism of Thioflavin-T binding to amyloid fibrils.</a> Biochimica et Biophysica Acta. 1804, 1405-1412 (2010).</li><li>Minic, J., Sautel, M., Salesse, R., Pajot-Augy, E. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Yeast+system+as+a+screening+tool+for+pharmacological+assessment+of+g+protein+coupled+receptors.">Yeast system as a screening tool for pharmacological assessment of g protein coupled receptors.</a> Current Medicinal Chemistry. 12, 961-969 (2005).</li><li>Schein, C. H. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=A+cool+way+to+make+proteins.">A cool way to make proteins.</a> Nature Biotechnology. 22, 826-827 (2004).</li><li>Sorensen, H. P., Mortensen, K. K. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Advanced+genetic+strategies+for+recombinant+protein+expression+in+Escherichia+coli.">Advanced genetic strategies for recombinant protein expression in Escherichia coli.</a> Journal of Biotechnology. 115, 113-128 (2005).</li><li>Zhang, J., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Disruption+of+glycosylation+enhances+ubiquitin-mediated+proteasomal+degradation+of+Shadoo+in+Scrapie-infected+rodents+and+cultured+cells.">Disruption of glycosylation enhances ubiquitin-mediated proteasomal degradation of Shadoo in Scrapie-infected rodents and cultured cells.</a> Molecular Neurobiology. 49, 1373-1384 (2014).</li><li>Englund, P. T. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+structure+and+biosynthesis+of+glycosyl+phosphatidylinositol+protein+anchors.">The structure and biosynthesis of glycosyl phosphatidylinositol protein anchors.</a> Annual Review of Biochemistry. 62, 121-138 (1993).</li><li>Puig, B., Altmeppen, H., Glatzel, M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+GPI-anchoring+of+PrP:+implications+in+sorting+and+pathogenesis.">The GPI-anchoring of PrP: implications in sorting and pathogenesis.</a> Prion. 8, 11-18 (2014).</li></ol>

The authors have nothing to disclose.

פרוטוקול קל ויעיל לשני ביטוי וטיהור של כמות גדולה של חלבון Shadoo עכבר רקומביננטי מוצג. השיטה המתוארת מאפשרת solubilization וטיהור (6) -tagged חלבון רקומביננטי Shadoo מוצלחים. חשוב, כפי שציינו בכותרת, שכאשר באו לידי ביטוי בחיידק E. פרוקריוטים coli Shadoo מצטבר בגופי הכללה. ל?...

מחלות ניווניות הפריון, הכוללות אנצפלופתיה שור ספגת בבקר, כבשים ומרוסקים במחלת קרויצפלד-יעקב בבני אדם, הן קטלניות וחשוכות מרפא. מחלות הפריון מתאפיינות בשינויי קונפורמציה חלבון הפריון הסלולרי של בעיקר מורכבים מα-סלילים, ל- β גיליון הצלב מועשר עמילואיד קונפורמיסט 1,2. צלב-β-מבנים מכילים צפופים וβ גליונות כמו גבישים-הורה מאוד התייצבו עם קשרי מימן 3,4. amyloids הפריון יכול לשכפל את עצמו בשל β-הגדילים בקצה הגובר המספקים תבנית לגיוס והמרת יחידת חלבון monomeric. על פי &quot;חלבון רק&quot; ההשערה, קונפורמיסט עמילואיד חלבון הפריון שלו הגורם המדבק הבלעדי. עם זאת, כמה מולקולות ביולוגיות אחרות הוצעו להיות חיוני להפרעות הפריון. למשל, קרום תא נחשב למקום שבו conversiבמתרחש וכמה שומנים טעונים שלילי הוכחו כדי לשפר את 5,6 תהליך הגיור. בנוסף, חלק מהחלבונים יכולים להיות גם מעורבים בפתולוגיות הפריון. באופן ספציפי, יש שני חברים אחרים במשפחת חלבון הפריון: דופל וShadoo 7,8. יש דופל מבנה קשיח יחסית התייצב עם גשרים די-גופרי ולא מצליח לפלמר עצמי ומצטבר לסיבי עמילואיד 9. לעומת זאת, דומה לחלבון הפריון, Shadoo יכול לאמץ מבנה מועשר-β גיליון ולשייך עצמי למבני ליפון עמילואיד. זה היה הראה כי Shadoo יכול לרעוד בתנאים מקומיים או על כריכת קרומים טעונים שלילי 10,11. המרה של Shadoo לתוך סיבים כמו עמילואיד-עשויה להיות קשורה לפתולוגיות. ואכן, המנגנונים שבאמצעותם מבנים דמויים-עמילואיד לגרום למחלות הם הבינו היטב. Shadoo נושא תחום הידרופובי (HD) וסדרה של טנדם Arg / גלאי חוזר לא דומהo חלק N- מסוף חלבון הפריון (איור 1 א) של. כחלק N- מסוף חלבון הפריון של, Shadoo הוא מאוד טעון חיובי ונראה כי חלבון מקורי לא מובנה 11,12. נראה Shadoo להיות פונקציונלי קשור להפרעות הפריון מאז אותו ישירות יכול להיקשר חלבון הפריון. בנוסף, הביטוי שלה מוסדר נחלש במהלך פתולוגיה הפריון 13,14. עם זאת, התפקיד של Shadoo במחלת הפריון עדיין לא הוקם. פיתחנו פלסמיד שנשא את רצף הקידוד של גן Shadoo העכבר. פלסמיד שימש להפוך E. coli לייצור חלבון Shadoo N-מסופו 6 היתוך של. מערכת ביטוי זה מבוסס היטב במעבדה שלנו ומשמשת בדרך כלל בפרויקטים המתמשכים שלנו 6,15,16. נושא חשוב לביטוי של Shadoo הוא הבחירה של א &#39; זן coli. בעוד זן חיידקי BL21 המוסמך משמש בדרך כלל לביטוי של פרו רקומביננטיחלבוני Shadoo בא לידי הביטוי בהצלחה וטיהר רק מזן החיידקים הפך SoluBL21. SoluBL21 א המוסמך coli הוא מוטציה משופרת של זן מארח BL21 פיתחה לייצור חלבוני ביטויו בBL21 ההורה לא נתן שום מוצר מסיס לזיהוי. ביטוי ברמה גבוהה של Shadoo בSoluBL21 E. coli מוביל להצטברות של החלבון בגוף הכללה. כתכונה כללית, כאשר חלבון שאינו ילידי הארץ באה לידי הביטוי ביותר בE. coli, חלבון זה נוטה להצטבר בגוף הכללה מסיס. Shadoo כנראה צובר באמצעות אינטראקציות שאינן קוולנטיים הידרופובי או יוניות (או שילוב של שניהם) למבנים דינמיים מועשרים שהוקמו על ידי החלבון המקופל לדרגות שונות. כתוצאה מכך, הטיהור כוללת לפחות שני שלבים: (i) הפרדה סלקטיבית של החלבון ממולקולות ביולוגיות אחרות במדיום denaturation, וכן (ii) renaturation של החלבון המטוהר באמצעות בקיפול מבחנהטכניקות. ההפרדה סלקטיבית של Shadoo הושגה בפתרון מאגר המכיל אוריאה 8M (או לחלופין 6M guanidine-HCl). הסרת האוריאה וrenaturation של החלבון יכולים להיעשות על ידי יישום פרוטוקולים שונים: renaturation (i) בפתרון ה- pH חומצי לקבל חלבון בלתי מובנה monomeric Shadoo, או (ii) renaturation בפתרון של pH ≥ 7 להשיג polymerized Shadoo לסיבי עמילואיד יציבים עם מוטיבים-β גיליון צלב אופייניים.

<table>
	<tbody>
		<tr>
			<td>AKTA FPLC&#160;</td>
			<td>GE, Amersham</td>
			<td># 1363</td>
			<td></td>
		</tr>
		<tr>
			<td>HiLoad 16/60 Superdex</td>
			<td>GE Healthcare</td>
			<td>17-1069-01</td>
			<td></td>
		</tr>
		<tr>
			<td>HiTrap IMAC</td>
			<td>GE Healthcare</td>
			<td>GE17-0920-05</td>
			<td></td>
		</tr>
		<tr>
			<td>HiPrep26/10 Desalting column</td>
			<td>GE Healthcare</td>
			<td>GE17-5087-01</td>
			<td></td>
		</tr>
		<tr>
			<td>SoluBL21 Competent E. coli</td>
			<td>Genlantis</td>
			<td>C700200</td>
			<td></td>
		</tr>
		<tr>
			<td>pET-28b+</td>
			<td>Novogen</td>
			<td>69865-3</td>
			<td></td>
		</tr>
		<tr>
			<td>IPTG</td>
			<td>Sigma-Aldrich</td>
			<td>I6758</td>
			<td></td>
		</tr>
		<tr>
			<td>LB-Broth medium</td>
			<td>Sigma-Aldrich</td>
			<td>L3022</td>
			<td></td>
		</tr>
		<tr>
			<td>Eppendorf Biophotometar</td>
			<td>Eppendorf</td>
			<td>550507804</td>
			<td></td>
		</tr>
		<tr>
			<td>Trito X-100</td>
			<td>Life Technologies</td>
			<td>85111</td>
			<td></td>
		</tr>
		<tr>
			<td>NiSO4</td>
			<td>Sigma-Aldrich</td>
			<td>656895</td>
			<td></td>
		</tr>
		<tr>
			<td>EDTA</td>
			<td>Sigma-Aldrich</td>
			<td>E6758</td>
			<td></td>
		</tr>
		<tr>
			<td>Tris-HCl</td>
			<td>Sigma-Aldrich</td>
			<td>RES3098T</td>
			<td></td>
		</tr>
		<tr>
			<td>Protease Inhibitor Cocktail Tablets</td>
			<td>Roche</td>
			<td>4693116001</td>
			<td></td>
		</tr>
		<tr>
			<td>NaCl</td>
			<td>Sigma-Aldrich</td>
			<td>746398</td>
			<td></td>
		</tr>
		<tr>
			<td>Imidazol</td>
			<td>Sigma-Aldrich</td>
			<td>I5513</td>
			<td></td>
		</tr>
		<tr>
			<td>Gdn-HCl</td>
			<td>Sigma-Aldrich</td>
			<td>G4505</td>
			<td></td>
		</tr>
		<tr>
			<td>protein size marker&#160;</td>
			<td>Thermo Fisher Scientific</td>
			<td>26620</td>
			<td></td>
		</tr>
	</tbody>
</table>

purification and refolding to amyloid fibrils of (his)6-tagged recombinant shadoo protein expressed as inclusion bodies in e. coli

מערכת ביטוי coli Escherichia היא כלי רב עוצמה לייצור חלבונים רקומביננטיים האיקריוטים. אנחנו משתמשים בו כדי לייצר Shadoo, חלבון השייך למשפחת הפריון. שיטת chromatographic לטיהור 6 -tagged Shadoo רקומביננטי (שלו) הביעה כגופי הכללה מתואר. גופי הכללתם בsolubilized 8 M אוריאה ומחויב לטור Ni 2 + -charged לבצע כרומטוגרפיה זיקת יון. חלבוני Bound הם eluted על ידי שיפוע של imidazole. שברים המכילים חלבון Shadoo נתונים לכרומטוגרפיה הדרת הגודל להשיג חלבון נקי במיוחד. בShadoo הצעד מטוהר הסופי desalted להסיר מלחים, אוריאה וimidazole. חלבון Shadoo רקומביננטי הוא מגיב חשוב למחקרים ביו-פיסיקליים וביוכימיים של הפרעות קונפורמציה חלבון המתרחשות במחלות הפריון. דיווחים רבים הראו כי מחלות ניווניות הפריון מקורן בתצהיר של דקירהle, הורה סיבי עמילואיד. פרוטוקולי מדגם מתארים כיצד לרעוד Shadoo לסיבי עמילואיד בחומץ וניטראלי / PHS הבסיסי מוצגים. השיטות על איך לייצר ולרעוד Shadoo יכול להקל על מחקר במעבדות עובדות על מחלות הפריון, שכן הוא מאפשר לייצור כמויות הגדולות של חלבון באופן מהיר ועלות נמוך.

על 5-10 מ&quot;ג חלבון Shadoo מטוהר של מתקבל לליטר תרבות חיידקים. יש צורך בטיהור שני שלבים כדי להשיג Shadoo רקומביננטי של טוהר גבוה. הצעד הראשון מתבצע על ידי כרומטוגרפיה זיקה עם טור -charged Ni 2 + ששומרת עליו-מתוייגים חלבונים. שברי eluted נתונים לSDS-PAGE ומוכתם בכחול מבריק Coomassie (?...

Watch this Scientific Journal Video about Purification and Refolding to Amyloid Fibrils of His6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli at JoVE.com

Purification and Refolding to Amyloid Fibrils of His6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli

A two-step chromatographic method is described for the purification of recombinant Shadoo protein expressed as inclusion bodies in Escherichia coli, as well as a protocol to fibrillate purified Shadoo into amyloid structures.

טיהור וקפל שוב לעמילואיד סיבים של (שלו)<sub&gt; 6</sub&gt; חלבון רקומביננטי Shadoo -tagged מבוטא גופי הכללה ב<em&gt; חיידק</em

The Escherichia coli expression system is a powerful tool for the production of recombinant eukaryotic proteins. We use it to produce Shadoo, a protein ...

purification-refolding-to-amyloid-fibrils-his6-tagged-recombinant

Research

JoVE Journal

Biology

Purification and Refolding to Amyloid Fibrils of (His)6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli

14.1K Views.  INRA. A two-step chromatographic method is described for the purification of recombinant Shadoo protein expressed as inclusion bodies in Escherichia coli, as well as a protocol to fibrillate purified Shadoo into amyloid structures. 

Video: Purification and Refolding to Amyloid Fibrils of His6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli

Staining of Proteins in Gels with Coomassie G-250 without Organic Solvent and Acetic Acid

In classical protein staining protocols using Coomassie Brilliant Blue (CBB), solutions with high contents of toxic and flammable organic solvents (Methanol, Ethanol or 2-Propanol) and acetic acid are used for fixation, staining and destaining of proteins in a gel after SDS-PAGE. To speed up the procedure, heating the staining solution in the microwave oven for a short time is frequently used. This usually results in evaporation of toxic or hazardous Methanol, Ethanol or 2-Propanol and a strong smell of acetic acid in the lab which should be avoided due to safety considerations. In a protocol originally published in two patent applications by E.M. Wondrak (US2001046709 (A1), US6319720 (B1)), an alternative composition of the staining solution is described in which no organic solvent or acid is used. The CBB is dissolved in bidistilled water (60-80mg of CBB G-250 per liter) and 35 mM HCl is added as the only other compound in the staining solution. The CBB staning of the gel is done after SDS-PAGE and thorough washing of the gel in bidistilled water. By heating the gel during the washing and staining steps, the process can be finished faster and no toxic or hazardous compunds are evaporating. The staining of proteins occurs already within 1 minute after heating the gel in staining solution and is fully developed after 15-30 min with a slightly blue background that is destained completely by prolonged washing of the stained gel in bidistilled water, without affecting the stained protein bands.

A short protocol for protein staining with Coomassie Brilliant Blue (CBB) G-250 in polyacrylamide gels is described without using organic solvents or acetic acid as in the classical staining procedures with CBB.

הכתמה של חלבונים עם ג&#39;ל Coomassie G-250 ללא חומצה אצטית ממס אורגני

In classical protein staining protocols using Coomassie Brilliant Blue (CBB), solutions with high contents of toxic and flammable organic solvents ...

Mutagenesis and Functional Selection Protocols for Directed Evolution of Proteins in E. coli

The efficient generation of genetic diversity represents an invaluable molecular tool that can be used to label DNA synthesis, to create unique molecular signatures, or to evolve proteins in the laboratory. Here, we present a protocol that allows the generation of large (>1011) mutant libraries for a given target sequence. This method is based on replication of a ColE1 plasmid encoding the desired sequence by a low-fidelity variant of DNA polymerase I (LF-Pol I). The target plasmid is transformed into a mutator strain of E. coli and plated on solid media, yielding between 0.2 and 1 mutations/kb, depending on the location of the target gene. Higher mutation frequencies are achieved by iterating this process of mutagenesis. Compared to alternative methods of mutagenesis, our protocol stands out for its simplicity, as no cloning or PCR are involved. Thus, our method is ideal for mutational labeling of plasmids or other Pol I templates or to explore large sections of sequence space for the evolution of activities not present in the original target. The tight spatial control that PCR or randomized oligonucleotide-based methods offer can also be achieved through subsequent cloning of specific sections of the library. Here we provide protocols showing how to create a random mutant library and how to establish drug-based selections in E. coli to identify mutants exhibiting new biochemical activities.

Mutagenesis and Functional Selection Protocols for Directed Evolution of Proteins in E. coli

Here we demonstrate a simple protocol to create a random mutant library for a given target sequence. We show how this method, which is performed in vivo in Escherichia coli, can be coupled with functional selections to evolve new enzymatic activities.

בחירת הפרוטוקולים mutagenesis ו פונקציונאלי אבולוציה מכוונת של חלבונים א coli</em

The efficient generation of genetic diversity represents an invaluable molecular tool that can be used to label DNA synthesis, to create unique molecular ...

Purification of Hsp104, a Protein Disaggregase

Hsp104 is a hexameric AAA+ protein1 from yeast, which couples ATP hydrolysis to protein disaggregation2-10 (Fig. 1). This activity imparts two key selective advantages. First, renaturation of disordered aggregates by Hsp104 empowers yeast survival after various protein-misfolding stresses, including heat shock3,5,11,12. Second, remodeling of cross-beta amyloid fibrils by Hsp104 enables yeast to exploit myriad prions (infectious amyloids) as a reservoir of beneficial and heritable phenotypic variation13-22. Remarkably, Hsp104 directly remodels preamyloid oligomers and amyloid fibrils, including those comprised of the yeast prion proteins Sup35 and Ure223-30. This amyloid-remodeling functionality is a specialized facet of yeast Hsp104. The E. coli orthologue, ClpB, fails to remodel preamyloid oligomers or amyloid fibrils26,31,32.
Hsp104 orthologues are found in all kingdoms of life except, perplexingly, animals. Indeed, whether animal cells possess any enzymatic system that couples protein disaggregation to renaturation (rather than degradation) remains unknown33-35. Thus, we and others have proposed that Hsp104 might be developed as a therapeutic agent for various neurodegenerative diseases connected with the misfolding of specific proteins into toxic preamyloid oligomers and amyloid fibrils4,7,23,36-38. There are no treatments that directly target the aggregated species associated with these diseases. Yet, Hsp104 dissolves toxic oligomers and amyloid fibrils composed of alpha-synuclein, which are connected with Parkinson's Disease23 as well as amyloid forms of PrP39. Importantly, Hsp104 reduces protein aggregation and ameliorates neurodegeneration in rodent models of Parkinson's Disease23 and Huntington's disease38. Ideally, to optimize therapy and minimize side effects, Hsp104 would be engineered and potentiated to selectively remodel specific aggregates central to the disease in question4,7. However, the limited structural and mechanistic understanding of how Hsp104 disaggregates such a diverse repertoire of aggregated structures and unrelated proteins frustrates these endeavors30,40-42.
To understand the structure and mechanism of Hsp104, it is essential to study the pure protein and reconstitute its disaggregase activity with minimal components. Hsp104 is a 102kDa protein with a pI of ~5.3, which hexamerizes in the presence of ADP or ATP, or at high protein concentrations in the absence of nucleotide43-46. Here, we describe an optimized protocol for the purification of highly active, stable Hsp104 from E. coli. The use of E. coli allows simplified large-scale production and our method can be performed quickly and reliably for numerous Hsp104 variants. Our protocol increases Hsp104 purity and simplifies His6-tag removal compared to a previous purification method from E. coli47. Moreover, our protocol is more facile and convenient than two more recent protocols26,48.

Here, we describe a protocol for the purification of highly active Hsp104, a hexameric AAA+ protein from yeast, which couples ATP hydrolysis to protein disaggregation. This scheme exploits a His6-tagged construct for affinity purification from E. coli followed by anion-exchange chromatography, His6-tag removal with TEV protease, and size-exclusion chromatography.

טיהור Hsp104, Disaggregase חלבון

Hsp104 is a hexameric AAA+ protein1 from yeast, which couples ATP hydrolysis to protein disaggregation2-10 (Fig. 1). This activity imparts two key ...

Identification of Protein Complexes in Escherichia coli using Sequential Peptide Affinity Purification in Combination with Tandem Mass Spectrometry

Since most cellular processes are mediated by macromolecular assemblies, the systematic identification of protein-protein interactions (PPI) and the identification of the subunit composition of multi-protein complexes can provide insight into gene function and enhance understanding of biological systems1, 2. Physical interactions can be mapped with high confidence vialarge-scale isolation and characterization of endogenous protein complexes under near-physiological conditions based on affinity purification of chromosomally-tagged proteins in combination with mass spectrometry (APMS). This approach has been successfully applied in evolutionarily diverse organisms, including yeast, flies, worms, mammalian cells, and bacteria1-6. In particular, we have generated a carboxy-terminal Sequential Peptide Affinity (SPA) dual tagging system for affinity-purifying native protein complexes from cultured gram-negative Escherichia coli, using genetically-tractable host laboratory strains that are well-suited for genome-wide investigations of the fundamental biology and conserved processes of prokaryotes1, 2, 7. Our SPA-tagging system is analogous to the tandem affinity purification method developed originally for yeast8, 9, and consists of a calmodulin binding peptide (CBP) followed by the cleavage site for the highly specific tobacco etch virus (TEV) protease and three copies of the FLAG epitope (3X FLAG), allowing for two consecutive rounds of affinity enrichment. After cassette amplification, sequence-specific linear PCR products encoding the SPA-tag and a selectable marker are integrated and expressed in frame as carboxy-terminal fusions in a DY330 background that is induced to transiently express a highly efficient heterologous bacteriophage lambda recombination system10. Subsequent dual-step purification using calmodulin and anti-FLAG affinity beads enables the highly selective and efficient recovery of even low abundance protein complexes from large-scale cultures. Tandem mass spectrometry is then used to identify the stably co-purifying proteins with high sensitivity (low nanogram detection limits).
Here, we describe detailed step-by-step procedures we commonly use for systematic protein tagging, purification and mass spectrometry-based analysis of soluble protein complexes from E. coli, which can be scaled up and potentially tailored to other bacterial species, including certain opportunistic pathogens that are amenable to recombineering. The resulting physical interactions can often reveal interesting unexpected components and connections suggesting novel mechanistic links. Integration of the PPI data with alternate molecular association data such as genetic (gene-gene) interactions and genomic-context (GC) predictions can facilitate elucidation of the global molecular organization of multi-protein complexes within biological pathways. The networks generated for E. coli can be used to gain insight into the functional architecture of orthologous gene products in other microbes for which functional annotations are currently lacking.

Identification of Protein Complexes in Escherichia coli using Sequential Peptide Affinity Purification in Combination with Tandem Mass Spectrometry

Affinity purification of tagged proteins in combination with mass spectrometry (APMS) is a powerful method for the systematic mapping of protein interaction networks and for investigating the mechanistic basis of biological processes. Here, we describe an optimized sequential peptide affinity (SPA) APMS procedure developed for the bacterium Escherichia coli that can be used to isolate and characterize stable multi-protein complexes to near homogeneity even starting from low copy numbers per cell.

זיהוי של קומפלקסי חלבונים ב<em&gt; חיידקי Escherichia</em&gt; באמצעות טיהור זיקת פפטיד סדרתית בשילוב עם טנדם המוני ספקטרומטריית

Since most cellular processes are mediated by macromolecular assemblies, the systematic identification of protein-protein interactions (PPI) and the ...

Coupled Assays for Monitoring Protein Refolding in Saccharomyces cerevisiae

Proteostasis, defined as the combined processes of protein folding/biogenesis, refolding/repair, and degradation, is a delicate cellular balance that must be maintained to avoid deleterious consequences 1. External or internal factors that disrupt this balance can lead to protein aggregation, toxicity and cell death. In humans this is a major contributing factor to the symptoms associated with neurodegenerative disorders such as Huntington's, Parkinson's, and Alzheimer's diseases 10. It is therefore essential that the proteins involved in maintenance of proteostasis be identified in order to develop treatments for these debilitating diseases. This article describes techniques for monitoring in vivo protein folding at near-real time resolution using the model protein firefly luciferase fused to green fluorescent protein (FFL-GFP). FFL-GFP is a unique model chimeric protein as the FFL moiety is extremely sensitive to stress-induced misfolding and aggregation, which inactivates the enzyme 12. Luciferase activity is monitored using an enzymatic assay, and the GFP moiety provides a method of visualizing soluble or aggregated FFL using automated microscopy. These coupled methods incorporate two parallel and technically independent approaches to analyze both refolding and functional reactivation of an enzyme after stress. Activity recovery can be directly correlated with kinetics of disaggregation and re-solubilization to better understand how protein quality control factors such as protein chaperones collaborate to perform these functions. In addition, gene deletions or mutations can be used to test contributions of specific proteins or protein subunits to this process. In this article we examine the contributions of the protein disaggregase Hsp104 13, known to partner with the Hsp40/70/nucleotide exchange factor (NEF) refolding system 5, to protein refolding to validate this approach.

Coupled Assays for Monitoring Protein Refolding in Saccharomyces cerevisiae

This article describes the use of a firefly luciferase-GFP fusion protein to investigate in vivo protein folding in Saccharomyces cerevisiae. Using this reagent, refolding of a model heat-denatured protein can be monitored simultaneously by fluorescence microscopy and an enzymatic assay to probe the roles of proteostasis network components in protein quality control.

מבחני יחד לrefolding החלבון בניטור<em&gt; Cerevisiae Saccharomyces</em

Proteostasis, defined as the combined processes of protein folding/biogenesis, refolding/repair, and degradation, is a delicate cellular balance that must ...

Purification of the Cystic Fibrosis Transmembrane Conductance Regulator Protein Expressed in Saccharomyces cerevisiae

Defects in the cystic fibrosis transmembrane conductance regulator (CFTR) protein cause cystic fibrosis (CF), an autosomal recessive disease that currently limits the average life expectancy of sufferers to &#60;40 years of age. The development of novel drug molecules to restore the activity of CFTR is an important goal in the treatment CF, and the isolation of functionally active CFTR is a useful step towards achieving this goal.
We describe two methods for the purification of CFTR from a eukaryotic heterologous expression system, S. cerevisiae. Like prokaryotic systems, S. cerevisiae can be rapidly grown in the lab at low cost, but can also traffic and posttranslationally modify large membrane proteins. The selection of detergents for solubilization and purification is a critical step in the purification of any membrane protein. Having screened for the solubility of CFTR in several detergents, we have chosen two contrasting detergents for use in the purification that allow the final CFTR preparation to be tailored to the subsequently planned experiments.
In this method, we provide comparison of the purification of CFTR in dodecyl-&#946;-D-maltoside (DDM) and 1-tetradecanoyl-sn-glycero-3-phospho-(1&#39;-rac-glycerol) (LPG-14). Protein purified in DDM by this method shows ATPase activity in functional assays. Protein purified in LPG-14 shows high purity and yield, can be employed to study post-translational modifications, and can be used for structural methods such as small-angle X-ray scattering and electron microscopy. However it displays significantly lower ATPase activity.

Purification of the Cystic Fibrosis Transmembrane Conductance Regulator Protein Expressed in Saccharomyces cerevisiae

Heterologous expression and purification of the cystic fibrosis transmembrane conductance regulator (CFTR) are significant challenges and limiting factors in the development of drug therapies for cystic fibrosis. This protocol describes two methods for the isolation of milligram quantities of CFTR suitable for functional and structural studies.&#160;

טיהור של חלבון הטרנסממברני מוליכות רגולטור סיסטיק פיברוזיס שבא לידי ביטוי ב<em&gt; Saccharomyces cerevisiae</em

Defects in the cystic fibrosis transmembrane conductance regulator (CFTR) protein cause cystic fibrosis (CF), an autosomal recessive disease that ...

High Throughput Quantitative Expression Screening and Purification Applied to Recombinant Disulfide-rich Venom Proteins Produced in E. coli

Escherichia coli (E. coli) is the most widely used expression system for the production of recombinant proteins for structural and functional studies. However, purifying proteins is sometimes challenging since many proteins are expressed in an insoluble form. When working with difficult or multiple targets it is therefore recommended to use high throughput (HTP) protein expression screening on a small scale (1-4&#160;ml cultures) to quickly identify conditions for soluble expression. To cope with the various structural genomics programs of the lab, a quantitative (within a range of 0.1-100 mg/L culture of recombinant protein) and HTP protein expression screening protocol was implemented and validated on thousands of proteins. The protocols were automated with the use of a liquid handling robot but can also be performed manually without specialized equipment.
Disulfide-rich venom proteins are gaining increasing recognition for their potential as therapeutic drug leads. They can be highly potent and selective, but their complex disulfide bond networks make them challenging to produce. As a member of the FP7 European Venomics project (<a href="http://www.venomics.eu">www.venomics.eu</a>), our challenge is to develop successful production strategies with the aim of producing thousands of novel venom proteins for functional characterization. Aided by the redox properties of disulfide bond isomerase DsbC, we adapted our HTP production pipeline for the expression of oxidized, functional venom peptides in the E. coli cytoplasm. The protocols are also applicable to the production of diverse disulfide-rich proteins. Here we demonstrate our pipeline applied to the production of animal venom proteins. With the protocols described herein it is likely that soluble disulfide-rich proteins will be obtained in as little as a week. Even from a small scale, there is the potential to use the purified proteins for validating the oxidation state by mass spectrometry, for characterization in pilot studies, or for sensitive micro-assays.

High Throughput Quantitative Expression Screening and Purification Applied to Recombinant Disulfide-rich Venom Proteins Produced in E. coli

A protocol for the quantitative, high throughput expression screening and analytical purification of fusion proteins from small-scale Escherichia coli cultures is described and applied to the expression of disulfide-rich animal venom protein targets.

הקרנת תפוקה גבוהה ביטוי כמותי וטיהור יישומים לחלבוני ארס רקומביננטי דיסולפיד עשירים הופק ב<em&gt; א coli</em

Escherichia coli (E. coli) is the most widely used expression system for the production of recombinant proteins for structural and functional studies. ...

Non-chromatographic Purification of Recombinant Elastin-like Polypeptides and their Fusions with Peptides and Proteins from Escherichia coli

Elastin-like polypeptides are repetitive biopolymers that exhibit a lower critical solution temperature phase transition behavior, existing as soluble unimers below a characteristic transition temperature and aggregating into micron-scale coacervates above their transition temperature. The design of elastin-like polypeptides at the genetic level permits precise control of their sequence and length, which dictates their thermal properties. Elastin-like polypeptides are used in a variety of applications including biosensing, tissue engineering, and drug delivery, where the transition temperature and biopolymer architecture of the ELP can be tuned for the specific application of interest. Furthermore, the lower critical solution temperature phase transition behavior of elastin-like polypeptides allows their purification by their thermal response, such that their selective coacervation and resolubilization allows the removal of both soluble and insoluble contaminants following expression in Escherichia coli. This approach can be used for the purification of elastin-like polypeptides alone or as a purification tool for peptide or protein fusions where recombinant peptides or proteins genetically appended to elastin-like polypeptide tags can be purified without chromatography. This protocol describes the purification of elastin-like polypeptides and their peptide or protein fusions and discusses basic characterization techniques to assess the thermal behavior of pure elastin-like polypeptide products.

Non-chromatographic Purification of Recombinant Elastin-like Polypeptides and their Fusions with Peptides and Proteins from Escherichia coli

Elastin-like polypeptides are stimulus-responsive biopolymers with applications ranging from recombinant protein purification to drug delivery. This protocol describes the purification and characterization of elastin-like polypeptides and their peptide or protein fusions from Escherichia coli using their lower critical solution temperature phase transition behavior as a simple alternative to chromatography.

טיהור ללא chromatographic של פוליפפטידים דמויי אלסטין רקומביננטי וFusions עם פפטידים וחלבונים מן<em&gt; חיידקי Escherichia</em

Elastin-like polypeptides are repetitive biopolymers that exhibit a lower critical solution temperature phase transition behavior, existing as soluble ...

Green Fluorescent Protein-based Expression Screening of Membrane Proteins in Escherichia coli

The production of recombinant membrane proteins for structural and functional studies remains technically challenging due to low levels of expression and the inherent instability of many membrane proteins once solubilized in detergents. A protocol is described that combines ligation independent cloning of membrane proteins as GFP fusions with expression in Escherichia coli detected by GFP fluorescence. This enables the construction and expression screening of multiple membrane protein/variants to identify candidates suitable for further investment of time and effort. The GFP reporter is used in a primary screen of expression by visualizing GFP fluorescence following SDS polyacrylamide gel electrophoresis (SDS-PAGE). Membrane proteins that show both a high expression level with minimum degradation as indicated by the absence of free GFP, are selected for a secondary screen. These constructs are scaled and a total membrane fraction prepared and solubilized in four different detergents. Following ultracentrifugation to remove detergent-insoluble material, lysates are analyzed by fluorescence detection size exclusion chromatography (FSEC). Monitoring the size exclusion profile by GFP fluorescence provides information about the mono-dispersity and integrity of the membrane proteins in different detergents. Protein: detergent combinations that elute with a symmetrical peak with little or no free GFP and minimum aggregation are candidates for subsequent purification. Using the above methodology, the heterologous expression in E. coli of SED (shape, elongation, division, and sporulation) proteins from 47 different species of bacteria was analyzed. These proteins typically have ten transmembrane domains and are essential for cell division. The results show that the production of the SEDs orthologues in E. coli was highly variable with respect to the expression levels and integrity of the GFP fusion proteins. The experiment identified a subset for further investigation.

Green Fluorescent Protein-based Expression Screening of Membrane Proteins in Escherichia coli

A streamlined approach to screening for the expression of recombinant membrane proteins in Escherichia coli based on fusion to green fluorescent protein is presented.

הקרנה ירוקה פלורסנט מבוסס חלבון ביטוי של החלבונים ממברנה ב<em&gt; Coli Escherichia</em

The production of recombinant membrane proteins for structural and functional studies remains technically challenging due to low levels of expression and ...

Phage-mediated Delivery of Targeted sRNA Constructs to Knock Down Gene Expression in E. coli

RNA-mediated knockdowns are widely used to control gene expression. This versatile family of techniques makes use of short RNA (sRNA) that can be synthesized with any sequence and designed to complement any gene targeted for silencing. Because sRNA constructs can be introduced to many cell types directly or using a variety of vectors, gene expression can be repressed in living cells without laborious genetic modification. The most common RNA knockdown technology, RNA interference (RNAi), makes use of the endogenous RNA-induced silencing complex (RISC) to mediate sequence recognition and cleavage of the target mRNA. Applications of this technique are therefore limited to RISC-expressing organisms, primarily eukaryotes. Recently, a new generation of RNA biotechnologists have developed alternative mechanisms for controlling gene expression through RNA, and so made possible RNA-mediated gene knockdowns in bacteria. Here we describe a method for silencing gene expression in E. coli that functionally resembles RNAi. In this system a synthetic phagemid is designed to express sRNA, which may designed to target any sequence. The expression construct is delivered to a population of E. coli cells with non-lytic M13 phage, after which it is able to stably replicate as a plasmid. Antisense recognition and silencing of the target mRNA is mediated by the Hfq protein, endogenous to E. coli. This protocol includes methods for designing the antisense sRNA, constructing the phagemid vector, packaging the phagemid into M13 bacteriophage, preparing a live cell population for infection, and performing the infection itself. The fluorescent protein mKate2 and the antibiotic resistance gene chloramphenicol acetyltransferase (CAT) are targeted to generate representative data and to quantify knockdown effectiveness.

Phage-mediated Delivery of Targeted sRNA Constructs to Knock Down Gene Expression in E. coli

We describe a method to knock down gene expression in a growing population of E. coli cells using sequence-targeted sRNA expression cassettes delivered by an M13 phagemid vector.