The authors would like to acknowledge Natalie Doude and David Westerway (University of Alberta) for providing us Sho cDNA, Christophe Chevalier (INRA) for plasmid construction, Michel Br&#233;mont (INRA) for providing us BL21Sol bacteria; Christine Longin (INRA) for TEM assistance and Edith Pajot-Augy (INRA) for comments and proofreading.

1. דור של ביטוי פלסמיד וShadoo הערה: חלבון Shadoo עכברי גן המקודד (Shadoo 25-122), היה subcloned לתוך וקטור ביטוי PET-28 11. שיבוט זה הפך לE. coli SoluBL21 זן חיידקים, להביע חלבון Shadoo עם תג N-מסוף hexahistidine, (HHHHHHHHHHSSGHIDDDDKHMKGGRGGARGSARGVRGGARGASRVRVRP APRYGSSLRVAAAGAAAGAAAGVAAGLATGSGWRRTSGPGELGLEDDENGAMGGNGTDRGVYSYWAWTSG) כפי שהוסבר בעבר 11. פלסמיד ניתן לבקש מהמחברים. המשקל המולקולרי של Shadoo מחושב מרצף חומצות אמינו שלה הוא 12,243.2 Da. הערה: בצע את כל המניפולציות עם חיידקים מתחת למכסת מנוע לזרום laminal או קרובה ללהבה בונזן. <ol style=";text-align:right;direction:rtl"><li style=";text-align:right;direction:rtl"> להפוך חיידקי SoluBL21 המוסמכים עם PET-28-פלסמיד -Shadoo 6, באמצעות פרוטוקול הלם חום סטנדרטי. לשם כך לערבב 1 עד 5 μl של פלסמיד (בדרך כלל 10 עמ &#39;100ng) לתוך 50 μl של החיידקים בצינור. בצע את הלם החום על 42 מעלות צלזיוס למשך 45 שניות. </li><li style=";text-align:right;direction:rtl"> תרבות הפכה חיידקים על 37 מעלות צלזיוס עד 600 של 0.5-0.7 במדיום לוריא-Bertani בתוספת 40 מ&quot;ג / מיליליטר kanamycin (איור 1). </li><li style=";text-align:right;direction:rtl"> לגרום O ביטוי Shadoo / N על ידי הוספת 240 מיקרוגרם איזופרופיל-β-D-thiogalactopyranoside / מיליליטר, ITPG, לתרבות. חיידקי תרבות תחת הרועד בסל&quot;ד 150 על 37 מעלות צלזיוס. הערה: בדרך כלל, תרבות חיידקים מגיעה 600 של 3 O / N. ניתן לאחסן חיידקים שינה ב -80 ° C לייצור חלבון עתיד: הערה. לשם כך, להוסיף 10% -50% (V / V) גליצרול סטרילי לaliquots תרבות חיידקים ולהקפיא אותם ב -80 ° C. </li></ol><img alt="איור 1" src="/files/ftp_upload/53432/53432fig1.jpg" /> תכנית איור 1. מבנה של ביטוי, שינוי Shadoo חיידקים ואינדוקציה של ביטוי Shadoo (כמתואר בשלב 1). </strong&gt; () מבנה הביטוי לShadoo מקודד תג hexahistidine התמזג N-הסופית של החלבון, NT. התכנית מראה כי חלבון Shadoo מכיל חזרות בסיסיות ארגינין / גליצין (גליל ירוק), תחום הידרופובי (HD), ואתר יחיד N-glycosylation (CHO), ואחריו C-סופית (CT). PET-28-6 -Shadoo פלסמיד (B) הופך לחיידקי SoluBL21 על ידי הלם חום במשך 45 שניות על 42 מעלות צלזיוס. חיידקים הפכו הם מצופים על אגר סלקטיבי המכיל 40 מיקרוגרם / מיליליטר kanamycin. מושבה אחת מהצלחת משמשת לחסן תרבות בבקבוק שייקר 1,000-3,000 מיליליטר. ביטוי של חלבון רקומביננטי מושרה עם IPTG 1 מ&quot;מ. <a href="https://www.jove.com/files/ftp_upload/53432/53432fig1highres.jpg" target="_blank">אנא לחץ כאן כדי לצפות בגרסה גדולה יותר של דמות זו.</a> 2. טיהור של חלבון Shadoo ידי כרומטוגרפיה נוזלית בלחץ נמוך (LPLC) <ol style=";text-align:right;direction:rtl"><li style=";text-align:right;direction:rtl"> תמוגה תא ובהכנת גופי clusion <ol style=";text-align:right;direction:rtl"><li style=";text-align:right;direction:rtl"> אסוף את ההשעיה החיידקים ולהעביר אותו לתוך צינורות צנטריפוגה (איור 2). </li><li style=";text-align:right;direction:rtl"> ספין ב2,500 XG, במשך 20 דקות ב 4 מעלות צלזיוס. הסר supernatant באמצעות אחסון וכדורים גלולים ב 15 מיליליטר חיץ (50 מ&quot;מ טריס, 10 mM EDTA, pH 8 עם קוקטייל אנטי-פרוטאז) לכל גלולה הנגזרת מ500 מיליליטר של תרבית תאים. הערה: אפשר להקפיא כדורי Resuspended ומאוחסנים ב -20 ° C במשך כמה ימים. הקפאה מאפשרת תמוגה תאי חיידקים. </li><li style=";text-align:right;direction:rtl"> בדוק את ביטוי היתר של חלבון רקומביננטי באמצעות כדורי חיידקים גולמיים על ידי ניתוח SDS-PAGE וצביעת Coomassie. <ol style=";text-align:right;direction:rtl"><li style=";text-align:right;direction:rtl"> לשם כך, מיליליטר צנטריפוגות 1 של תרבות חיידקים לגלולת תאים. הוספת 100 פתרון μl Laemmli denaturation (277.8 מ&quot;מ טריס-HCl, pH 6.8, 4.4% SDS, 44.4% w / v גליצרול, bromophenol 0.02% הכחולים) לגלולה וחום ב 100 מעלות צלזיוס למשך 5 דקות. </li><li style=";text-align:right;direction:rtl"> עומס 10 μl של המדגם לג&#39;ל acrylamide 12%, SDS-PAGE וVisu לרוץAlize מופרד חלבונים על ידי צביעת Coomassie. </li></ol></li><li style=";text-align:right;direction:rtl"> להוסיף Triton X-100 0.5% ריכוז סופי לגלולה המושעית לחלוטין מ2.1.2). </li><li style=";text-align:right;direction:rtl"> דגירה ההשעיה באמבט מים על 37 מעלות צלזיוס למשך 30 דקות. </li><li style=";text-align:right;direction:rtl"> Sonicate ההשעיה של 5 דקות ב6-12 מיקרון משרעת שיא-לשיא במים קר כקרח לlyse תאי חיידקים. </li><li style=";text-align:right;direction:rtl"> העברת sonicated השעיה לתוך 50 מיליליטר צינורות צנטריפוגה נקיים. </li><li style=";text-align:right;direction:rtl"> צינורות צנטריפוגה ב 15,000 XG במשך 15 דקות ב 4 מעלות צלזיוס. </li><li style=";text-align:right;direction:rtl"> הסר supernatant באמצעות אחסון ולהוסיף 5 מיליליטר של החיץ המחייב (20 מ&quot;מ טריס החיץ-HCl, pH 7.4, 0.5 M NaCl, 8 M אוריאה, 5 מ&quot;מ Imidazole) לכל צינור. </li><li style=";text-align:right;direction:rtl"> מקום צינורות על O גלגל / N מסתובב לresuspend לחלוטין חלבונים מגופי הכללה. </li></ol><img alt="איור 2" src="/files/ftp_upload/53432/53432fig2.jpg" /> תכנית איור 2. טיהור ההכללהגופים (כמתואר בשלב 2.1). שינה חיידקים להביע Shadoo נקצרים על ידי צנטריפוגה וresuspended במאגר תמוגה. ההשעיה היא טופחה על 37 מעלות צלזיוס למשך 30 דקות, ולאחר מכן sonicated לשבור מכאני תאי חיידקים. Sonication נעשה על קרח כדי למנוע חימום מדגם. תאים שבורים נקצרים על ידי צנטריפוגה וresuspended במאגר המכיל 8 M אוריאה לsolubilize חלבונים מגופי הכללה. <a href="https://www.jove.com/files/ftp_upload/53432/53432fig2highres.jpg" target="_blank">אנא לחץ כאן כדי לצפות בגרסה גדולה יותר של דמות זו.</a> </li><li style=";text-align:right;direction:rtl"> כרומטוגרפיה -affinity Ni 2 + הערה: כרומטוגרפיה מבוצעת על מערכת FPLC באמצעות 2 + Ni -charged, 5 מיליליטר עמודת chelating Sepharose (איור 3 א). כל הפתרונות מועמסים על העמודה עם קצב זרימה של 1 מיליליטר / דקה. <ol style=";text-align:right;direction:rtl"><li style=";text-align:right;direction:rtl"> הזרק 10 מיליליטר של 0.2 פתרון 4 מים M Niso לטור Sepharose כדי לחייב אותועם -ions 2 + Ni. </li><li style=";text-align:right;direction:rtl"> לאזן את העמודה טעונה עם -ions Ni 2 + על ידי הזרקת 30-50 מיליליטר של חיץ המחייב המכיל ריכוז נמוך של imidazole (20 מ&quot;מ טריס חיץ-HCl, pH 7.4, 0.5 M NaCl, 8 M אוריאה, 5 מ&quot;מ Imidazole). </li><li style=";text-align:right;direction:rtl"> טען את החלבונים-solubilized אוריאה עם הזרקת לולאת 50 מיליליטר. </li><li style=";text-align:right;direction:rtl"> לשחזר את חלק הזרימה דרך על ידי שטיפה יסודית הטור עם 10 מיליליטר חיץ imidazole הנמוך מחייב (20 מ&quot;מ טריס חיץ-HCl, pH 7.4, 0.5 M NaCl, 8 M אוריאה, 5 מ&quot;מ Imidazole) כדי להסיר את מקסימום של חלבונים מאוגד מהטור. </li><li style=";text-align:right;direction:rtl"> לשטוף את העמודה עם 50-100 מיליליטר של חיץ הכביסה (20 מ&quot;מ טריס-HCl, pH 7.4, 0.5 M NaCl, 8 M אוריאה, 80 מ&quot;מ imidazole) לelute חלבונים שאינם קשורים באופן ספציפי לעמודה. </li><li style=";text-align:right;direction:rtl"> החל שיפוע ליניארית 15 דקות של 80-800 מ&quot;מ Imidazole במאגר המכיל 20 מ&quot;מ טריס-HCl, pH 7.4, 0.5 M NaCl, 8 M אוריאה. לאסוף 1 מיליליטר שברים במהלך היישום ההדרגתי. הערה: מתויגים-חלבונים eluted שנינותשיפוע דונם של מאגר המכיל imidazole (המשמש כמתחרה). </li><li style=";text-align:right;direction:rtl"> קח aliquot 8 μl של כל חלק ולהוסיף פתרון denaturation 4 μl 4x Laemmli (ראה 2.1.3.1). פתרונות חום של 100 מעלות צלזיוס למשך 5 דקות. </li><li style=";text-align:right;direction:rtl"> עומס 10 μl של סמן גודל חלבון ו -10 μl של כל דגימה לג&#39;ל acrylamide 12%, SDS-PAGE לרוץ ולדמיין חלבונים מופרדים על ידי צביעת Coomassie. הערה: המשקל המולקולרי של Shadoo מחושב ליצור רצף חומצות אמינו הוא 12,243.2 Da. </li><li style=";text-align:right;direction:rtl"> בריכה כל השברים המכילים Shadoo. </li></ol><img alt="איור 3" src="/files/ftp_upload/53432/53432fig3.jpg" /> איור 3. הליך טיהור (כפי שמתואר בשלבים 2.2-2.4). יכול להיות מתואם 2 + -ions () ניקל על ידי שאריות היסטידין, המאפשרת טיהור סלקטיבית של חלבונים מתויג polyhistidine. Imidazole משמש לelute החלבון, דרךיכולתה לתאם עם -ion Ni 2 + ולעקור את החלבון הקשור. (ב) חלבונים של רדיוס הידרודינמית שונה שנשמרו בNi 2 + -column מופרדים על עמודת הדרת גודל. חלבונים eluted מהגדולים ביותר לקטן ביותר. (ג) לפני השימוש, שברים המכילים Shadoo הם אספו וdesalted להסיר אוריאה, imidazole ומלחים. מבחני בקרת איכות כוללים SDS-PAGE / הכתמת Coomassie, מערבי סופג. ניתן להקפיא-מיובש המטוהר Shadoo. Lyophilized Shadoo יציב במשך חודשים כאשר מאוחסנים ב -20 מעלות צלזיוס. <a href="https://www.jove.com/files/ftp_upload/53432/53432fig3highres.jpg" target="_blank">אנא לחץ כאן כדי לצפות בגרסה גדולה יותר של דמות זו.</a> </li><li style=";text-align:right;direction:rtl"> כרומטוגרפיה הדרת גודל הערה: צעד טיהור שני מורכב בכרומטוגרפיה הדרת גודל שמפרידה בין חלבון Shadoo מחלבונים האחרים לשתף eluted במהלך שלב הטיהור הראשון(איור 3). <ol style=";text-align:right;direction:rtl"><li style=";text-align:right;direction:rtl"> לאזן טור Superdex של 120 מיליליטר הכולל מיטה נפח ידי הזרקת 250 מיליליטר של חיץ 20 מ&quot;מ טריס-HCl, pH 7.4, 0.5 M NaCl, 8 M אוריאה בקצב הזרימה של 1.5 מיליליטר / דקה. </li><li style=";text-align:right;direction:rtl"> ברי עומס נקוו מכילים Shadoo מ2.2.9 על עמודת equilibrated. לאסוף 1 מיליליטר שברים אחרי הטור-חלל הנפח של 40 מיליליטר על הזרימה המתמדת של המאגר לעיל. </li><li style=";text-align:right;direction:rtl"> קח aliquot 10 μl של כל חלק ולבצע ניתוח SDS-PAGE וצביעת Coomassie כפי שתואר לעיל כדי לגלות שברים להכיל Shadoo. </li><li style=";text-align:right;direction:rtl"> שברים בריכה המכילים Shadoo. </li></ol></li><li style=";text-align:right;direction:rtl"> Desalting הערה: הליך desalting מסיר מלחים, imidazole ואוריאה להשיג חלבון Shadoo רקומביננטי במאגר מתאים למחקרים נוספים biophysical וביוכימיים (איור 3 ג). ניתן להשיג אותה התוצאה על ידי dialyzing דגימות נגד המאגר. <ol style=";text-align:right;direction:rtl"><li style=";text-align:right;direction:rtl"> לאזן טור desalting של 53 מיליליטר עם 150 מיליליטרשל חיץ 10 מ&quot;מ אמוניום אצטט, pH 5, בקצב זרימה של 5 מיליליטר / דקה. </li><li style=";text-align:right;direction:rtl"> עומס אספו שברים Shadoo על העמודה. עם ההזרקה של חיץ אמוניום אצטט לאסוף ידני שברים שמצביעים על עלייה של האות ב 280 ננומטר במוצא של גלאי UV. </li><li style=";text-align:right;direction:rtl"> להקפיא-ייבוש Shadoo desalted ולאחסן אותו ב -20 מעלות צלזיוס. </li><li style=";text-align:right;direction:rtl"> ממיסים Shadoo lyophilized בחיץ הולם, כגון 10 חיץ נתרן אצטט מ&quot;מ, pH 5, לפני שימוש. הערה: תג polyhistidine ניתן להסיר עם enterokinase. </li></ol></li></ol> 3. במבחנה הרכבה של Shadoo לעמילואיד סיבים בפיזיולוגי pH הערה: אגרגטים חלבון Shadoo וספונטני יוצרים סיבים ב- pH ≥ 7 11. <img alt="איור 4" src="/files/ftp_upload/53432/53432fig4.jpg" /> איור 4. תכנית של Shadoo מקפל לסיבי עמילואיד (כdescriהמיטה בשלב 3). מזוקק Shadoo ספונטנית ממירה לסיבי עמילואיד כאשר מומסים במאגר של ≥ pH 7. בתמיסה חומצית, Shadoo ממיר לסיבי עמילואיד על דגירה עם 1 M GDN-HCl תוך רעד. מבחני בקרת איכות כוללים מיקרוסקופיה אלקטרונית וצביעת tht. <a href="https://www.jove.com/files/ftp_upload/53432/53432fig4highres.jpg" target="_blank">אנא לחץ כאן כדי לצפות בגרסה גדולה יותר של דמות זו.</a> <ol style=";text-align:right;direction:rtl"><li style=";text-align:right;direction:rtl"> לדלל Shadoo לריכוז סופי של 2 מיקרומטר במאגר 20 מ&quot;מ טריס- HCl, pH 7.4. למדוד את הריכוז על ידי מדידת הצפיפות האופטית של הפתרון ב 280 ננומטר ובאמצעות מקדם ההכחדה להסיק מרכב חומצות אמינו Shadoo של 20970. </li><li style=";text-align:right;direction:rtl"> דגירה 500 μl של הפתרון בצינור פלסטיק חרוטי על 4 מעלות צלזיוס במשך כמה שבועות, כדי לאפשר המרת חלבון ספונטנית למבני עמילואיד (איור 4). </li><li style=";text-align:right;direction:rtl"> הוסף מוכן טרי thioflavin T (THT) לconce סופיntration של 10 מיקרומטר לaliquot 100 μl של פתרון Shadoo. דגירה הפתרון למשך 5 דקות על RT. למדוד פליטת הקרינה 460-520 ננומטר באמצעות גל עירור של 435 ננומטר כדי לאמת את נוכחותם של מבני עמילואיד 17. </li></ol> 4. במבחנה הרכבה של Shadoo לעמילואיד סיבים בחומציים PHS <ol style=";text-align:right;direction:rtl"><li style=";text-align:right;direction:rtl"> לדלל Shadoo ב 1 M GdnHCl, חיץ 20 מ&quot;מ Na-אצטט, pH 5 לריכוז סופי של 2 מיקרומטר. </li><li style=";text-align:right;direction:rtl"> דגירה 500 μl של פתרון זה בצינור חרוטי עם רעד מתמשך על 37 מעלות צלזיוס, ל3-7 ימים. </li><li style=";text-align:right;direction:rtl"> לבדוק הנוכחות של סיבי עמילואיד על ידי הוספת tht לaliquot של הפתרון כמו ב3.3. </li><li style=";text-align:right;direction:rtl"> Dialyze השעיה התקבלה נגד 10 חיץ מ&quot;מ Na-אצטט, pH 5.0, לטהר סיבי עמילואיד Shadoo. </li><li style=";text-align:right;direction:rtl"> אחסן סיבים מטוהרים ב+4 מעלות צלזיוס. </li></ol><img alt="איור 5" src="/files/ftp_upload/53432/53432fig5.jpg"/&gt; איור 5. נציגי תוצאות. שברי חלבון eluted מNi 2 + -charged עמודת chelating () ועמודה הדרת גודל (ב &#39;) נותחו באמצעות SDS-PAGE וצביעת Coomassie. זיהוי של Shadoo המטוהר הוערך באמצעות נוגדן SPRN אנטי Shadoo (C). <a href="https://www.jove.com/files/ftp_upload/53432/53432fig5large.jpg" target="_blank">אנא לחץ כאן כדי לצפות בגרסה גדולה יותר של דמות זו.</a>

<ol><li>Biasini, E., Turnbaugh, J. A., Unterberger, U., Harris, D. A. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((Prion+protein+at+the+crossroads+of+physiology+and+disease%5BTitle%5D)+AND+%22Trends+in+Neurosciences%22%5BJournal%5D)">Prion protein at the crossroads of physiology and disease.</a> Trends in Neurosciences. 35, 92-103 (2012).</li>
<li>Colby, D. W., Prusiner, S. B. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((De+novo+generation+of+prion+strains%5BTitle%5D)+AND+%22Nature+Reviews.+Microbiology%22%5BJournal%5D)">De novo generation of prion strains.</a> Nature Reviews. Microbiology. 9, 771-777 (2011).</li>
<li>Chiti, F., Dobson, C. M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((Protein+misfolding%2C+functional+amyloid%2C+and+human+disease%5BTitle%5D)+AND+%22Annual+Review+of+Biochemistry%22%5BJournal%5D)">Protein misfolding, functional amyloid, and human disease.</a> Annual Review of Biochemistry. 75, 333-366 (2006).</li>
<li>Nelson, R., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((Structure+of+the+cross-beta+spine+of+amyloid-like+fibrils%5BTitle%5D)+AND+%22Nature%22%5BJournal%5D)">Structure of the cross-beta spine of amyloid-like fibrils.</a> Nature. 435, 773-778 (2005).</li>
<li>Murphy, R. M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((Kinetics+of+amyloid+formation+and+membrane+interaction+with+amyloidogenic+proteins%5BTitle%5D)+AND+%22Biochimica+et+Biophysica+Acta%22%5BJournal%5D)">Kinetics of amyloid formation and membrane interaction with amyloidogenic proteins.</a> Biochimica et Biophysica Acta. 1768, 1923-1934 (2007).</li>
<li>Steunou, S., Chich, J. F., Rezaei, H., Vidic, J. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((Biosensing+of+lipid-prion+interactions%3A+insights+on+charge+effect%2C+Cu%28II%29-ions+binding+and+prion+oligomerization%5BTitle%5D)+AND+%22Biosensors+%26+Bioelectronics%22%5BJournal%5D)">Biosensing of lipid-prion interactions: insights on charge effect, Cu(II)-ions binding and prion oligomerization.</a> Biosensors & Bioelectronics. 26, 1399-1406 (2010).</li>
<li>Watts, J. C., Westaway, D. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((The+prion+protein+family%3A+diversity%2C+rivalry%2C+and+dysfunction%5BTitle%5D)+AND+%22Biochimica+et+Biophysica+Acta%22%5BJournal%5D)">The prion protein family: diversity, rivalry, and dysfunction.</a> Biochimica et Biophysica Acta. 1772, 654-672 (2007).</li>
<li>Westaway, D., Daude, N., Wohlgemuth, S., Harrison, P. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((The+PrP-like+proteins+Shadoo+and+Doppel%5BTitle%5D)+AND+%22Topics+in+Current+Chemistry%22%5BJournal%5D)">The PrP-like proteins Shadoo and Doppel.</a> Topics in Current Chemistry. 305, 225-256 (2011).</li>
<li>Baillod, P., Garrec, J., Tavernelli, I., Rothlisberger, U. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((Prion+versus+doppel+protein+misfolding%3A+new+insights+from+replica-exchange+molecular+dynamics+simulations%5BTitle%5D)+AND+%22Biochemistry%22%5BJournal%5D)">Prion versus doppel protein misfolding: new insights from replica-exchange molecular dynamics simulations.</a> Biochemistry. 52, 8518-8526 (2013).</li>
<li>Daude, N., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((Wild-type+Shadoo+proteins+convert+to+amyloid-like+forms+under+native+conditions%5BTitle%5D)+AND+%22Journal+of+Neurochemistry%22%5BJournal%5D)">Wild-type Shadoo proteins convert to amyloid-like forms under native conditions.</a> Journal of Neurochemistry. 113, 92-104 (2010).</li>
<li>Li, Q., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((Shadoo+binds+lipid+membranes+and+undergoes+aggregation+and+fibrillization%5BTitle%5D)+AND+%22Biochemical+and+Biophysical+Research+Communications%22%5BJournal%5D)">Shadoo binds lipid membranes and undergoes aggregation and fibrillization.</a> Biochemical and Biophysical Research Communications. 438, 519-525 (2013).</li>
<li>Watts, J. C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((The+CNS+glycoprotein+Shadoo+has+PrP%28C%29-like+protective+properties+and+displays+reduced+levels+in+prion+infections%5BTitle%5D)+AND+%22The+EMBO+Journal%22%5BJournal%5D)">The CNS glycoprotein Shadoo has PrP(C)-like protective properties and displays reduced levels in prion infections.</a> The EMBO Journal. 26, 4038-4050 (2007).</li>
<li>Watts, J. C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((Protease-resistant+prions+selectively+decrease+Shadoo+protein%5BTitle%5D)+AND+%22PLoS+Pathogens%22%5BJournal%5D)">Protease-resistant prions selectively decrease Shadoo protein.</a> PLoS Pathogens. 7, e1002382(2011).</li>
<li>Westaway, D., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((Down-regulation+of+Shadoo+in+prion+infections+traces+a+pre-clinical+event+inversely+related+to+PrP%28Sc%29+accumulation%5BTitle%5D)+AND+%22PLoS+Pathogens%22%5BJournal%5D)">Down-regulation of Shadoo in prion infections traces a pre-clinical event inversely related to PrP(Sc) accumulation.</a> PLoS Pathogens. 7, e1002391(2011).</li>
<li>Chevalier, C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((PB1-F2+influenza+A+virus+protein+adopts+a+beta-sheet+conformation+and+forms+amyloid+fibers+in+membrane+environments%5BTitle%5D)+AND+%22The+Journal+of+Biological+Chemistry%22%5BJournal%5D)">PB1-F2 influenza A virus protein adopts a beta-sheet conformation and forms amyloid fibers in membrane environments.</a> The Journal of Biological Chemistry. 285, 13233-13243 (2010).</li>
<li>Tarus, B., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((Oligomerization+paths+of+the+nucleoprotein+of+influenza+A+virus%5BTitle%5D)+AND+%22Biochimie%22%5BJournal%5D)">Oligomerization paths of the nucleoprotein of influenza A virus.</a> Biochimie. 94, 776-785 (2012).</li>
<li>Biancalana, M., Koide, S. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((Molecular+mechanism+of+Thioflavin-T+binding+to+amyloid+fibrils%5BTitle%5D)+AND+%22Biochimica+et+Biophysica+Acta%22%5BJournal%5D)">Molecular mechanism of Thioflavin-T binding to amyloid fibrils.</a> Biochimica et Biophysica Acta. 1804, 1405-1412 (2010).</li>
<li>Minic, J., Sautel, M., Salesse, R., Pajot-Augy, E. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((Yeast+system+as+a+screening+tool+for+pharmacological+assessment+of+g+protein+coupled+receptors%5BTitle%5D)+AND+%22Current+Medicinal+Chemistry%22%5BJournal%5D)">Yeast system as a screening tool for pharmacological assessment of g protein coupled receptors.</a> Current Medicinal Chemistry. 12, 961-969 (2005).</li>
<li>Schein, C. H. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((A+cool+way+to+make+proteins%5BTitle%5D)+AND+%22Nature+Biotechnology%22%5BJournal%5D)">A cool way to make proteins.</a> Nature Biotechnology. 22, 826-827 (2004).</li>
<li>Sorensen, H. P., Mortensen, K. K. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((Advanced+genetic+strategies+for+recombinant+protein+expression+in+Escherichia+coli%5BTitle%5D)+AND+%22Journal+of+Biotechnology%22%5BJournal%5D)">Advanced genetic strategies for recombinant protein expression in Escherichia coli.</a> Journal of Biotechnology. 115, 113-128 (2005).</li>
<li>Zhang, J., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((Disruption+of+glycosylation+enhances+ubiquitin-mediated+proteasomal+degradation+of+Shadoo+in+Scrapie-infected+rodents+and+cultured+cells%5BTitle%5D)+AND+%22Molecular+Neurobiology%22%5BJournal%5D)">Disruption of glycosylation enhances ubiquitin-mediated proteasomal degradation of Shadoo in Scrapie-infected rodents and cultured cells.</a> Molecular Neurobiology. 49, 1373-1384 (2014).</li>
<li>Englund, P. T. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((The+structure+and+biosynthesis+of+glycosyl+phosphatidylinositol+protein+anchors%5BTitle%5D)+AND+%22Annual+Review+of+Biochemistry%22%5BJournal%5D)">The structure and biosynthesis of glycosyl phosphatidylinositol protein anchors.</a> Annual Review of Biochemistry. 62, 121-138 (1993).</li>
<li>Puig, B., Altmeppen, H., Glatzel, M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((The+GPI-anchoring+of+PrP%3A+implications+in+sorting+and+pathogenesis%5BTitle%5D)+AND+%22Prion%22%5BJournal%5D)">The GPI-anchoring of PrP: implications in sorting and pathogenesis.</a> Prion. 8, 11-18 (2014).</li>
</ol>

The authors have nothing to disclose.

פרוטוקול קל ויעיל לשני ביטוי וטיהור של כמות גדולה של חלבון Shadoo עכבר רקומביננטי מוצג. השיטה המתוארת מאפשרת solubilization וטיהור (6) -tagged חלבון רקומביננטי Shadoo מוצלחים. חשוב, כפי שציינו בכותרת, שכאשר באו לידי ביטוי בחיידק E. פרוקריוטים coli Shadoo מצטבר בגופי הכללה. לפני טיהור Shadoo, חיידקים צריכים להיות lysed ידי sonication במאגר המכיל טריטון X-100. בהמשך לכך יכולים להיות solubilized גופי הכללה בפתרון denaturing 8 M אוריאה. יתר על כן, כל תהליך הטיהור צריכה להתבצע בפתרון 8 חיץ M אוריאה מאז Shadoo נוטה פלמר ומצטבר. לאחר solubilization והבהרה של גופי הכללה, supernatant המכיל חלבונים מפוגלים הוא נתון להליך בן שני שלבים לטיהור: כרומטוגרפיה זיקה וכרומטוגרפיה גודל הדרה. Chromatog הזיקהצעד רפי מורכב במחייב Shadoo באמצעות -tag (6) ל2+ Ni -charged עמודת chelating. ב 8 M חלבוני פתרון אוריאה הם מפוגלים ושאריות היסטידין משטח חשוף. בנוסף, אוריאה מקדמת שלמות מבנית Shadoo ידי מניעת proteolysis במקרה של זיהום פרוטאזות. בשלב הטיהור השני, Shadoo eluted מעם השיפוע של imidazole נתונה כרומטוגרפיה גודל הדרה על מנת להפריד חלבונים מזהמים. במהלך השלב השני, חלבונים גדולים eluted ראשון, כפי שהם לא הצליחו להיכנס לנקבוביות של המטריצה, ולכן, יש לי נתיב ישיר דרך העמודה. חלבונים קטנים יותר, כמו Shadoo, ייקחו זמן רב יותר לelute מהעמודה שכן הם יכולים להיכנס לנקבוביות ויש נתיב מפותל יותר. לבסוף, הכנת חלבון desalted להסיר אוריאה, imidazole ומלחים. בקרת איכות מציינת כי בעקבות Shadoo רקומביננטי הליך זה מטוהר לטוהר גבוה. זה יכול להיות מנוצל בנמחקרים ביולוגיים ויוטכנולוגיים arious. א מערכת ביטוי coli היא כלי מאוד שימושי לביטוי של חלבונים רקומביננטי. העלות הנמוכה, מניפולציה קלה, המהירות ונוחות של להביע חלבונים יונקים בE. coli להפוך של מארח זה כלי הבחירה הראשון עבור יישומים בתחום מדעי חיים. עם זאת, לא ניתן לבטא את כל החלבונים היונקים בצורה מסיסה ו / או בכמות מספקת בזה חיידקים. לפעמים, ניתן להתגבר על מכשולים על ידי אסטרטגיות שונות כמו הורדת טמפרטורת ביטוי, שינוי יזמים, הוספת תגי טיהור, באמצעות תקשורת אלטרנטיבית 18-20. עם זאת, במקרים מסוימים, מציאת מצב ביטוי אופטימלי עשויה להיות עלות גבוהה בזמן ובמאמצים. קשיים לייצר Shadoo רקומביננטי היו להתגבר עם א המוסמך SoluBL21 זן coli. זן מארח מוטציה זו שיפר באופן משמעותי את התשואה של ייצור Shadoo ואיפשר לנו להשיג מסיס באופן מלאShadoo. תשואות שהשיגו היו בתרבות / L 5-10 מ&quot;ג הטווח. רקומביננטי Shadoo הוצג להיות חלבון מקורי לא מובנה נותן תכונה אקראי-ידי סליל ספקטרוסקופיה dichroism המעגלי 11,12. להיות חלבון מאוד טעון חיובי (PI ~ 10.44) Shadoo נוטה לצבור בpH הפיזיולוגי. עם זאת, Shadoo הוא מסיס באופן מלא בפתרונות מאגר של PHS חומצי. הצגנו כאן פרוטוקולים פשוטים ויעילים לפלמר Shadoo לסיבי עמילואיד בPHS השונים. Polymerized Shadoo מייצג כלי רב ערך כדי ללמוד foldings חלבון פתולוגי המאפיינים כמה מחלות ניווניות. Shadoo רקומביננטי מטוהר באמצעות ההליך שלנו יכול לשמש לאפיונים ביוכימיים ומבניים נוספים של תהליך המעבר קונפורמציה. בהתבסס על המבנה הראשוני שלה, Shadoo היה צפוי שתהיה לי פפטידים אתר אחד glycosylation N צמוד ואות להתקשרות של glycosylphosphatidylinositol עוגן (GPI) ליד C-הסופית (איור 1 א) שלה. Shadoo רקומביננטי מטוהר מגופי הכללה הוא משולל הפחמימות מאז מערכת ביטוי E.coli היא לא מסוגלת לבצע לאחר translational שינויים. כתוצאה מכך, אינטראקציות של Shadoo רקומביננטי עם חלבונים, שומנים או חומצות גרעין עשויות להיות שונה בהשוואה לחלבון הילידים. לדוגמא, את החשיבות של glycosylation Shadoo הוצעה לאחרונה לשפלת פרוטאזום Shadoo לאחר שינוי חלבון על ידי ubiquitination 21. התפקיד של עוגן GPI במחלת הפריון אינו ידוע, אך מחקרים רבים מצביעים על כך שעוגן GPI עשוי לשחק תפקיד בפתוגנזה של מחלות הפריון 22,23. כך, חיידקים הביעו Shadoo יכול לשמש למחקרים במבחנה תוך לקיחה בחשבון מגבלות אלה.

מחלות ניווניות הפריון, הכוללות אנצפלופתיה שור ספגת בבקר, כבשים ומרוסקים במחלת קרויצפלד-יעקב בבני אדם, הן קטלניות וחשוכות מרפא. מחלות הפריון מתאפיינות בשינויי קונפורמציה חלבון הפריון הסלולרי של בעיקר מורכבים מα-סלילים, ל- β גיליון הצלב מועשר עמילואיד קונפורמיסט 1,2. צלב-β-מבנים מכילים צפופים וβ גליונות כמו גבישים-הורה מאוד התייצבו עם קשרי מימן 3,4. amyloids הפריון יכול לשכפל את עצמו בשל β-הגדילים בקצה הגובר המספקים תבנית לגיוס והמרת יחידת חלבון monomeric. על פי &quot;חלבון רק&quot; ההשערה, קונפורמיסט עמילואיד חלבון הפריון שלו הגורם המדבק הבלעדי. עם זאת, כמה מולקולות ביולוגיות אחרות הוצעו להיות חיוני להפרעות הפריון. למשל, קרום תא נחשב למקום שבו conversiבמתרחש וכמה שומנים טעונים שלילי הוכחו כדי לשפר את 5,6 תהליך הגיור. בנוסף, חלק מהחלבונים יכולים להיות גם מעורבים בפתולוגיות הפריון. באופן ספציפי, יש שני חברים אחרים במשפחת חלבון הפריון: דופל וShadoo 7,8. יש דופל מבנה קשיח יחסית התייצב עם גשרים די-גופרי ולא מצליח לפלמר עצמי ומצטבר לסיבי עמילואיד 9. לעומת זאת, דומה לחלבון הפריון, Shadoo יכול לאמץ מבנה מועשר-β גיליון ולשייך עצמי למבני ליפון עמילואיד. זה היה הראה כי Shadoo יכול לרעוד בתנאים מקומיים או על כריכת קרומים טעונים שלילי 10,11. המרה של Shadoo לתוך סיבים כמו עמילואיד-עשויה להיות קשורה לפתולוגיות. ואכן, המנגנונים שבאמצעותם מבנים דמויים-עמילואיד לגרום למחלות הם הבינו היטב. Shadoo נושא תחום הידרופובי (HD) וסדרה של טנדם Arg / גלאי חוזר לא דומהo חלק N- מסוף חלבון הפריון (איור 1 א) של. כחלק N- מסוף חלבון הפריון של, Shadoo הוא מאוד טעון חיובי ונראה כי חלבון מקורי לא מובנה 11,12. נראה Shadoo להיות פונקציונלי קשור להפרעות הפריון מאז אותו ישירות יכול להיקשר חלבון הפריון. בנוסף, הביטוי שלה מוסדר נחלש במהלך פתולוגיה הפריון 13,14. עם זאת, התפקיד של Shadoo במחלת הפריון עדיין לא הוקם. פיתחנו פלסמיד שנשא את רצף הקידוד של גן Shadoo העכבר. פלסמיד שימש להפוך E. coli לייצור חלבון Shadoo N-מסופו 6 היתוך של. מערכת ביטוי זה מבוסס היטב במעבדה שלנו ומשמשת בדרך כלל בפרויקטים המתמשכים שלנו 6,15,16. נושא חשוב לביטוי של Shadoo הוא הבחירה של א &#39; זן coli. בעוד זן חיידקי BL21 המוסמך משמש בדרך כלל לביטוי של פרו רקומביננטיחלבוני Shadoo בא לידי הביטוי בהצלחה וטיהר רק מזן החיידקים הפך SoluBL21. SoluBL21 א המוסמך coli הוא מוטציה משופרת של זן מארח BL21 פיתחה לייצור חלבוני ביטויו בBL21 ההורה לא נתן שום מוצר מסיס לזיהוי. ביטוי ברמה גבוהה של Shadoo בSoluBL21 E. coli מוביל להצטברות של החלבון בגוף הכללה. כתכונה כללית, כאשר חלבון שאינו ילידי הארץ באה לידי הביטוי ביותר בE. coli, חלבון זה נוטה להצטבר בגוף הכללה מסיס. Shadoo כנראה צובר באמצעות אינטראקציות שאינן קוולנטיים הידרופובי או יוניות (או שילוב של שניהם) למבנים דינמיים מועשרים שהוקמו על ידי החלבון המקופל לדרגות שונות. כתוצאה מכך, הטיהור כוללת לפחות שני שלבים: (i) הפרדה סלקטיבית של החלבון ממולקולות ביולוגיות אחרות במדיום denaturation, וכן (ii) renaturation של החלבון המטוהר באמצעות בקיפול מבחנהטכניקות. ההפרדה סלקטיבית של Shadoo הושגה בפתרון מאגר המכיל אוריאה 8M (או לחלופין 6M guanidine-HCl). הסרת האוריאה וrenaturation של החלבון יכולים להיעשות על ידי יישום פרוטוקולים שונים: renaturation (i) בפתרון ה- pH חומצי לקבל חלבון בלתי מובנה monomeric Shadoo, או (ii) renaturation בפתרון של pH ≥ 7 להשיג polymerized Shadoo לסיבי עמילואיד יציבים עם מוטיבים-β גיליון צלב אופייניים.

<table><tbody><tr><td>AKTA FPLC&amp;nbsp;</td><td>GE, Amersham</td><td># 1363</td><td></td></tr><tr><td>HiLoad 16/60 Superdex</td><td>GE Healthcare</td><td>17-1069-01</td><td></td></tr><tr><td>HiTrap IMAC</td><td>GE Healthcare</td><td>GE17-0920-05</td><td></td></tr><tr><td>HiPrep26/10 Desalting column</td><td>GE Healthcare</td><td>GE17-5087-01</td><td></td></tr><tr><td>SoluBL21 Competent E. coli</td><td>Genlantis</td><td>C700200</td><td></td></tr><tr><td>pET-28b+</td><td>Novogen</td><td>69865-3</td><td></td></tr><tr><td>IPTG</td><td>Sigma-Aldrich</td><td>I6758</td><td></td></tr><tr><td>LB-Broth medium</td><td>Sigma-Aldrich</td><td>L3022</td><td></td></tr><tr><td>Eppendorf Biophotometar</td><td>Eppendorf</td><td>550507804</td><td></td></tr><tr><td>Trito X-100</td><td>Life Technologies</td><td>85111</td><td></td></tr><tr><td>NiSO4</td><td>Sigma-Aldrich</td><td>656895</td><td></td></tr><tr><td>EDTA</td><td>Sigma-Aldrich</td><td>E6758</td><td></td></tr><tr><td>Tris-HCl</td><td>Sigma-Aldrich</td><td>RES3098T</td><td></td></tr><tr><td>Protease Inhibitor Cocktail Tablets</td><td>Roche</td><td>4693116001</td><td></td></tr><tr><td>NaCl</td><td>Sigma-Aldrich</td><td>746398</td><td></td></tr><tr><td>Imidazol</td><td>Sigma-Aldrich</td><td>I5513</td><td></td></tr><tr><td>Gdn-HCl</td><td>Sigma-Aldrich</td><td>G4505</td><td></td></tr><tr><td>protein size marker&amp;nbsp;</td><td>Thermo Fisher Scientific</td><td>26620</td><td></td></tr></tbody></table>

purification and refolding to amyloid fibrils of (his)6-tagged recombinant shadoo protein expressed as inclusion bodies in e. coli

מערכת ביטוי coli Escherichia היא כלי רב עוצמה לייצור חלבונים רקומביננטיים האיקריוטים. אנחנו משתמשים בו כדי לייצר Shadoo, חלבון השייך למשפחת הפריון. שיטת chromatographic לטיהור 6 -tagged Shadoo רקומביננטי (שלו) הביעה כגופי הכללה מתואר. גופי הכללתם בsolubilized 8 M אוריאה ומחויב לטור Ni 2 + -charged לבצע כרומטוגרפיה זיקת יון. חלבוני Bound הם eluted על ידי שיפוע של imidazole. שברים המכילים חלבון Shadoo נתונים לכרומטוגרפיה הדרת הגודל להשיג חלבון נקי במיוחד. בShadoo הצעד מטוהר הסופי desalted להסיר מלחים, אוריאה וimidazole. חלבון Shadoo רקומביננטי הוא מגיב חשוב למחקרים ביו-פיסיקליים וביוכימיים של הפרעות קונפורמציה חלבון המתרחשות במחלות הפריון. דיווחים רבים הראו כי מחלות ניווניות הפריון מקורן בתצהיר של דקירהle, הורה סיבי עמילואיד. פרוטוקולי מדגם מתארים כיצד לרעוד Shadoo לסיבי עמילואיד בחומץ וניטראלי / PHS הבסיסי מוצגים. השיטות על איך לייצר ולרעוד Shadoo יכול להקל על מחקר במעבדות עובדות על מחלות הפריון, שכן הוא מאפשר לייצור כמויות הגדולות של חלבון באופן מהיר ועלות נמוך.

על 5-10 מ&quot;ג חלבון Shadoo מטוהר של מתקבל לליטר תרבות חיידקים. יש צורך בטיהור שני שלבים כדי להשיג Shadoo רקומביננטי של טוהר גבוה. הצעד הראשון מתבצע על ידי כרומטוגרפיה זיקה עם טור -charged Ni 2 + ששומרת עליו-מתוייגים חלבונים. שברי eluted נתונים לSDS-PAGE ומוכתם בכחול מבריק Coomassie (איור 5 א). שברים המכילים חלבון Shadoo הם אספו ומטוהרים יותר על ידי כרומטוגרפיה גודל הדרה שמפרידה חלבונים על פי גודלם (משקל מולקולרי Shadoo הוא כ -12 KDA). שברים שנאספו על elution הם דמיינו ידי SDS-PAGE / ניתוח Coomassie (איור 5). בנוסף, Shadoo עדות למערב-כתם באמצעות נוגדן ספציפי נגד Shadoo, SPRN שנקשר לאפיטופ רגיש בין 76-105 חומצות אמינו מאזור C-מסוף החלבון (איור 5 ג). Shadoo מקפל לסיבי myloid מאומתים על ידי צביעת tht (איור 6 א) ועל ידי מיקרוסקופי אלקטרונים מכתים שלילי (איור 6). Tht הוא צבע ניאון אשר נקשר מבני רבעוני-β גיליון צלב אופייניים למכלולי עמילואיד. עלייה בעוצמת tht באיור 6 א מצביעה על כך שShadoo מומר למבני amyloidal. <img alt="איור 6" src="/files/ftp_upload/53432/53432fig6.jpg" /> 6. תוצאות איור נציג. סיבי Shadoo (א) לריכוז שווה ערך מונומר 2 מיקרומטר היו preincubated עם tht (10 מיקרומטר ריכוז סופי) עבור 5 דקות ב RT. עוצמות פליטת פלורסנט נרשמות עבור כל דגימה באמצעות גל עירור ב435 ננומטר. שים לב לעלייה משמעותית בעוצמת הקרינה tht בתמיסה המכילה Shadoo polymerized לסיבי עמילואיד בהשוואה לשל השליטהolution של Shadoo monomeric. במיקרוסקופ אלקטרונים הילוכים (B) של Shadoo פירפר. <a href="https://www.jove.com/files/ftp_upload/53432/53432fig6highres.jpg" target="_blank">אנא לחץ כאן כדי לצפות בגרסה גדולה יותר של דמות זו.</a>

Watch this Scientific Journal Video about Purification and Refolding to Amyloid Fibrils of His6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli at JoVE.com

Purification and Refolding to Amyloid Fibrils of His6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli

A two-step chromatographic method is described for the purification of recombinant Shadoo protein expressed as inclusion bodies in Escherichia coli, as well as a protocol to fibrillate purified Shadoo into amyloid structures.

טיהור וקפל שוב לעמילואיד סיבים של (שלו)<sub&gt; 6</sub&gt; חלבון רקומביננטי Shadoo -tagged מבוטא גופי הכללה ב<em&gt; חיידק</em

The Escherichia coli expression system is a powerful tool for the production of recombinant eukaryotic proteins. We use it to produce Shadoo, a protein ...

purification-refolding-to-amyloid-fibrils-his-6-tagged-recombinant

Nanyang Technological University

Research

JoVE Journal

Biology

Purification and Refolding to Amyloid Fibrils of (His)6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli

14.1K Views.  INRA. A two-step chromatographic method is described for the purification of recombinant Shadoo protein expressed as inclusion bodies in Escherichia coli, as well as a protocol to fibrillate purified Shadoo into amyloid structures. 

Video: Purification and Refolding to Amyloid Fibrils of His6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli

Selection of Aptamers for Amyloid &beta;-Protein, the Causative Agent of Alzheimer&#39;s Disease

Alzheimer's disease (AD) is a progressive, age-dependent, neurodegenerative disorder with an insidious course that renders its presymptomatic diagnosis difficult1. Definite AD diagnosis is achieved only postmortem, thus establishing presymptomatic, early diagnosis of AD is crucial for developing and administering effective therapies2,3.
Amyloid &beta;-protein (A&beta;) is central to AD pathogenesis. Soluble, oligomeric A&beta; assemblies are believed to affect neurotoxicity underlying synaptic dysfunction and neuron loss in AD4,5. Various forms of soluble A&beta; assemblies have been described, however, their interrelationships and relevance to AD etiology and pathogenesis are complex and not well understood6. Specific molecular recognition tools may unravel the relationships amongst A&beta; assemblies and facilitate detection and characterization of these assemblies early in the disease course before symptoms emerge. Molecular recognition commonly relies on antibodies. However, an alternative class of molecular recognition tools, aptamers, offers important advantages relative to antibodies7,8. Aptamers are oligonucleotides generated by in-vitro selection: systematic evolution of ligands by exponential enrichment (SELEX)9,10. SELEX is an iterative process that, similar to Darwinian evolution, allows selection, amplification, enrichment, and perpetuation of a property, e.g., avid, specific, ligand binding (aptamers) or catalytic activity (ribozymes and DNAzymes).
Despite emergence of aptamers as tools in modern biotechnology and medicine11, they have been underutilized in the amyloid field. Few RNA or ssDNA aptamers have been selected against various forms of prion proteins (PrP)12-16. An RNA aptamer generated against recombinant bovine PrP was shown to recognize bovine PrP-&beta;17, a soluble, oligomeric, &beta;-sheet-rich conformational variant of full-length PrP that forms amyloid fibrils18. Aptamers generated using monomeric and several forms of fibrillar &beta;2-microglobulin (&beta;2m) were found to bind fibrils of certain other amyloidogenic proteins besides &beta;2m fibrils19. Ylera et al. described RNA aptamers selected against immobilized monomeric A&beta;4020. Unexpectedly, these aptamers bound fibrillar A&beta;40. Altogether, these data raise several important questions. Why did aptamers selected against monomeric proteins recognize their polymeric forms? Could aptamers against monomeric and/or oligomeric forms of amyloidogenic proteins be obtained? To address these questions, we attempted to select aptamers for covalently-stabilized oligomeric A&beta;4021 generated using photo-induced cross-linking of unmodified proteins (PICUP)22,23. Similar to previous findings17,19,20, these aptamers reacted with fibrils of A&beta; and several other amyloidogenic proteins likely recognizing a potentially common amyloid structural aptatope21. Here, we present the SELEX methodology used in production of these aptamers21.

Selection of Aptamers for Amyloid &#946;-Protein, the Causative Agent of Alzheimer's Disease

Aptamers are short ribo-/deoxyribo-oligonucleotides selected by in-vitro evolution methods based on affinity for a specific target. Aptamers are molecular recognition tools with versatile therapeutic, diagnostic, and research applications. We demonstrate methods for selection of aptamers for amyloid &beta;-protein, the causative agent of Alzheimer's disease.

מבחר Aptamers עבור חלבון β עמילואיד, הסוכן סיבתי של מחלת אלצהיימר

Alzheimer's disease (AD) is a progressive, age-dependent, neurodegenerative disorder with an insidious course that renders its presymptomatic diagnosis ...

Neuroscience

A Tailored HPLC Purification Protocol That Yields High-purity Amyloid Beta 42 and Amyloid Beta 40 Peptides, Capable of Oligomer Formation

Amyloidogenic peptides such as the Alzheimer's disease-implicated Amyloid beta (A&#946;), can present a significant challenge when trying to obtain high purity material. Here we present a tailored HPLC purification protocol to produce high-purity amyloid beta 42 (A&#946;42) and amyloid beta 40 (A&#946;40) peptides. We have found that the combination of commercially available hydrophobic poly(styrene/divinylbenzene) stationary phase, polymer laboratory reverse phase - styrenedivinylbenzene (PLRP-S) under high pH conditions, enables the attainment of high purity (&gt;95%) A&#946;42 in a single chromatographic run. The purification is highly reproducible and can be amended to both semi-preparative and analytical conditions depending upon the amount of material wished to be purified. The protocol can also be applied to the A&#946;40 peptide with identical success and without the need to alter the method.

Herein we report a tailored HPLC purification protocol that yields high-purity amyloid beta 42 (A&#946;42) and amyloid beta 40 (A&#946;40) peptides, capable of oligomer formation. Amyloid beta is a highly aggregation prone, hydrophobic peptide implicated in Alzheimer&#39;s disease. The amyloidogenic nature of the peptide makes its purification a challenge.

פרוטוקול טיהור HPLC המותאמים כי תשואות גבוהות טוהר עמילואיד בטא 42 ו עמילואיד בטא 40 פפטידים, מסוגל גיבוש oligomer

Amyloidogenic peptides such as the Alzheimer's disease-implicated Amyloid beta (A&#946;), can present a significant challenge when trying to obtain high ...

Biochemistry

Method for Efficient Refolding and Purification of Chemoreceptor Ligand Binding Domain

Identification of natural ligands of chemoreceptors and structural studies aimed at elucidation of the molecular basis of the ligand specificity can be greatly facilitated by the production of milligram amounts of pure, folded ligand binding domains. Attempts to heterologously express periplasmic ligand binding domains of bacterial chemoreceptors in Escherichia coli (E. coli) often result in their targeting into inclusion bodies. Here, a method is presented for protein recovery from inclusion bodies, its refolding and purification, using the periplasmic dCACHE ligand binding domain of Campylobacter jejuni (C. jejuni) chemoreceptor Tlp3 as an example. The approach involves expression of the protein of interest with a cleavable His6-tag, isolation and urea-mediated solubilisation of inclusion bodies, protein refolding by urea depletion, and purification by means of affinity chromatography, followed by tag removal and size-exclusion chromatography. The circular dichroism spectroscopy is used to confirm the folded state of the pure protein. It has been demonstrated that this protocol is generally useful for production of milligram amounts of dCACHE periplasmic ligand binding domains of other bacterial chemoreceptors in a soluble and crystallisable form.

A procedure is presented for the refolding of the dCACHE periplasmic ligand binding domain of Campylobacter jejuni chemoreceptor Tlp3 from inclusion bodies and the purification to yield milligram quantities of protein.

שיטת Refolding יעילה וטיהור של ליגנד Chemoreceptor מחייב תחום

Identification of natural ligands of chemoreceptors and structural studies aimed at elucidation of the molecular basis of the ligand specificity can be ...

Screening for Amyloid Aggregation by Semi-Denaturing Detergent-Agarose Gel Electrophoresis

Amyloid aggregation is associated with numerous protein misfolding pathologies and underlies the infectious properties of prions, which are conformationally self-templating proteins that are thought to have beneficial roles in lower organisms.  Amyloids have been notoriously difficult to study due to their insolubility and structural heterogeneity.  However, resolution of amyloid polymers based on size and detergent insolubility has been made possible by Semi-Denaturing Detergent-Agarose Gel Electrophoresis (SDD-AGE).  This technique is finding widespread use for the detection and characterization of amyloid conformational variants.  Here, we demonstrate an adaptation of this technique that facilitates its use in large-scale applications, such as screens for novel prions and other amyloidogenic proteins.  The new SDD-AGE method uses capillary transfer for greater reliability and ease of use, and allows any sized gel to be accomodated.  Thus, a large number of samples, prepared from cells or purified proteins, can be processed simultaneously for the presence of SDS-insoluble conformers of tagged proteins.

SDD-AGE is a useful technique for the detection and characterization of amyloid-like polymers in cells. Here we demonstrate an adaptation that makes this technique amenable to large-scale applications.

הקרנת עבור צבירת עמילואיד על ידי חצי Denaturing אלקטרופורזה דטרגנט-agarose ג&#39;ל

Amyloid aggregation is associated with numerous protein misfolding pathologies and underlies the infectious properties of prions, which are ...

Purification and Aggregation of the Amyloid Precursor Protein Intracellular Domain

Amyloid precursor protein (APP) is a type I transmembrane protein associated with the pathogenesis of Alzheimer's disease (AD). APP is characterized by a large extracellular domain and a short cytosolic domain termed the APP intracellular domain (AICD). During maturation through the secretory pathway, APP can be cleaved by proteases termed &alpha;, &beta;, and &gamma;-secretases1. Sequential proteolytic cleavage of APP with &beta; and &gamma;-secretases leads to the production of a small proteolytic peptide, termed A&beta;, which is amyloidogenic and the core constituent of senile plaques. The AICD is also liberated from the membrane after secretase processing, and through interactions with Fe65 and Tip60, can translocate to the nucleus to participate in transcription regulation of multiple target genes2,3. Protein-protein interactions involving the AICD may affect trafficking, processing, and cellular functions of holo-APP and its C-terminal fragments. We have recently shown that AICD can aggregate in vitro, and this process is inhibited by the AD-implicated molecular chaperone ubiquilin-14. Consistent with these findings, the AICD has exposed hydrophobic domains and is intrinsically disordered in vitro5,6, however it obtains stable secondary structure when bound to Fe657. We have proposed that ubiquilin-1 prevents inappropriate inter- and intramolecular interactions of AICD, preventing aggregation in vitro and in intact cells4. While most studies focus on the role of APP in the pathogenesis of AD, the role of AICD in this process is not clear. Expression of AICD has been shown to induce apoptosis8, to modulate signaling pathways9, and to regulate calcium signaling10. Over-expression of AICD and Fe65 in a transgenic mouse model induces Alzheimer's like pathology11, and recently AICD has been detected in brain lysates by western blotting when using appropriate antigen retrieval techniques12. To facilitate structural, biochemical, and biophysical studies of the AICD, we have developed a procedure to produce recombinantly large amounts of highly pure AICD protein. We further describe a method for inducing the in vitro thermal aggregation of AICD and analysis by atomic force microscopy. The methods described are useful for biochemical, biophysical, and structural characterization of the AICD and the effects of molecular chaperones on AICD aggregation.

A method for large-scale purification of the APP intracellular domain (AICD) is described. We also describe methodology to induce in vitro AICD aggregation and visualization by atomic force microscopy. The methods described are useful for biochemical/structural characterization of the AICD and the effects of molecular chaperones on its aggregation.

טיהור וצבירה של תחום החלבון המבשר עמילואיד התאי

Amyloid precursor protein (APP) is a type I transmembrane protein associated with the pathogenesis of Alzheimer's disease (AD). APP is characterized by a ...

Medicine

Expression, Purification, Crystallization, and Enzyme Assays of Fumarylacetoacetate Hydrolase Domain-Containing Proteins

Fumarylacetoacetate hydrolase (FAH) domain-containing proteins (FAHD) are identified members of the FAH superfamily in eukaryotes. Enzymes of this superfamily generally display multi-functionality, involving mainly hydrolase and decarboxylase mechanisms. This article presents a series of consecutive methods for the expression and purification of FAHD proteins, mainly FAHD protein 1 (FAHD1) orthologues among species (human, mouse, nematodes, plants, etc.). Covered methods are protein expression in E. coli, affinity chromatography, ion exchange chromatography, preparative and analytical gel filtration, crystallization, X-ray diffraction, and photometric assays. Concentrated protein of high levels of purity (&#62;98%) may be employed for crystallization or antibody production. Proteins of similar or lower quality may be employed in enzyme assays or used as antigens in detection systems (Western-Blot, ELISA). In the discussion of this work, the identified enzymatic mechanisms of FAHD1 are outlined to describe its hydrolase and decarboxylase bi-functionality in more detail.

Expression and purification of fumarylacetoacetate hydrolase domain-containing proteins is described with examples (expression in E. coli, FPLC). Purified proteins are used for crystallization and antibody production and employed for enzyme assays. Selected photometric assays are presented to display the multi-functionality of FAHD1 as oxaloacetate decarboxylase and acylpyruvate hydrolase.

ביטוי, טיהור, התגבשות ואנזים אנזימים המכילים חלבונים בתחום הידרוקלז

Fumarylacetoacetate hydrolase (FAH) domain-containing proteins (FAHD) are identified members of the FAH superfamily in eukaryotes. Enzymes of this ...

Purification of Hsp104, a Protein Disaggregase

Hsp104 is a hexameric AAA+ protein1 from yeast, which couples ATP hydrolysis to protein disaggregation2-10 (Fig. 1). This activity imparts two key selective advantages. First, renaturation of disordered aggregates by Hsp104 empowers yeast survival after various protein-misfolding stresses, including heat shock3,5,11,12. Second, remodeling of cross-beta amyloid fibrils by Hsp104 enables yeast to exploit myriad prions (infectious amyloids) as a reservoir of beneficial and heritable phenotypic variation13-22. Remarkably, Hsp104 directly remodels preamyloid oligomers and amyloid fibrils, including those comprised of the yeast prion proteins Sup35 and Ure223-30. This amyloid-remodeling functionality is a specialized facet of yeast Hsp104. The E. coli orthologue, ClpB, fails to remodel preamyloid oligomers or amyloid fibrils26,31,32.
Hsp104 orthologues are found in all kingdoms of life except, perplexingly, animals. Indeed, whether animal cells possess any enzymatic system that couples protein disaggregation to renaturation (rather than degradation) remains unknown33-35. Thus, we and others have proposed that Hsp104 might be developed as a therapeutic agent for various neurodegenerative diseases connected with the misfolding of specific proteins into toxic preamyloid oligomers and amyloid fibrils4,7,23,36-38. There are no treatments that directly target the aggregated species associated with these diseases. Yet, Hsp104 dissolves toxic oligomers and amyloid fibrils composed of alpha-synuclein, which are connected with Parkinson's Disease23 as well as amyloid forms of PrP39. Importantly, Hsp104 reduces protein aggregation and ameliorates neurodegeneration in rodent models of Parkinson's Disease23 and Huntington's disease38. Ideally, to optimize therapy and minimize side effects, Hsp104 would be engineered and potentiated to selectively remodel specific aggregates central to the disease in question4,7. However, the limited structural and mechanistic understanding of how Hsp104 disaggregates such a diverse repertoire of aggregated structures and unrelated proteins frustrates these endeavors30,40-42.
To understand the structure and mechanism of Hsp104, it is essential to study the pure protein and reconstitute its disaggregase activity with minimal components. Hsp104 is a 102kDa protein with a pI of ~5.3, which hexamerizes in the presence of ADP or ATP, or at high protein concentrations in the absence of nucleotide43-46. Here, we describe an optimized protocol for the purification of highly active, stable Hsp104 from E. coli. The use of E. coli allows simplified large-scale production and our method can be performed quickly and reliably for numerous Hsp104 variants. Our protocol increases Hsp104 purity and simplifies His6-tag removal compared to a previous purification method from E. coli47. Moreover, our protocol is more facile and convenient than two more recent protocols26,48.

Here, we describe a protocol for the purification of highly active Hsp104, a hexameric AAA+ protein from yeast, which couples ATP hydrolysis to protein disaggregation. This scheme exploits a His6-tagged construct for affinity purification from E. coli followed by anion-exchange chromatography, His6-tag removal with TEV protease, and size-exclusion chromatography.

טיהור Hsp104, Disaggregase חלבון

Hsp104 is a hexameric AAA+ protein1 from yeast, which couples ATP hydrolysis to protein disaggregation2-10 (Fig. 1). This activity imparts two key ...

Rapid Generation of Amyloid from Native Proteins In vitro

Proteins carry out crucial tasks in organisms by exerting functions elicited from their specific three dimensional folds. Although the native structures of polypeptides fulfill many purposes, it is now recognized that most proteins can adopt an alternative assembly of beta-sheet rich amyloid. Insoluble amyloid fibrils are initially associated with multiple human ailments, but they are increasingly shown as functional players participating in various important cellular processes. In addition, amyloid deposited in patient tissues contains nonproteinaceous components, such as nucleic acids and glycosaminoglycans (GAGs). These cofactors can facilitate the formation of amyloid, resulting in the generation of different types of insoluble precipitates. By taking advantage of our understanding how proteins misfold via an intermediate stage of soluble amyloid precursor, we have devised a method to convert native proteins to amyloid fibrils in vitro. This approach allows one to prepare amyloid in large quantities, examine the properties of amyloid generated from specific proteins, and evaluate the structural changes accompanying the conversion.

Rapid Generation of Amyloid from Native Proteins In vitro

Proteins can either adopt a native structure or misfold into insoluble amyloid. Conditions that favor the misfolding pathway lead to the formation of different types of amyloid fibrils. The methods described here allow rapid conversion of native proteins into amyloid in vitro.

דור מהיר של עמילואיד מחלבונים שפת אם<em&gt; במבחנה</em

Proteins carry out crucial tasks in organisms by exerting functions elicited from their specific three dimensional folds. Although the native structures ...

Biochemical Purification and Proteomic Characterization of Amyloid Fibril Cores from the Brain

Proteinaceous fibrillar inclusions are key pathological hallmarks of multiple neurodegenerative diseases. In the early stages of Alzheimer&#39;s disease (AD), amyloid-beta peptides form protofibrils in the extracellular space, which act as seeds that gradually grow and mature into large amyloid plaques. Despite this basic understanding, current knowledge of the amyloid fibril structure, composition, and deposition patterns in the brain is limited. One major barrier has been the inability to isolate highly purified amyloid fibrils from brain extracts. Affinity purification and laser capture microdissection-based approaches have been previously used to isolate amyloids but are limited by the small quantity of material that can be recovered. This novel, robust protocol describes the biochemical purification of amyloid plaque cores using sodium dodecyl sulfate (SDS) solubilization with sucrose density gradient ultracentrifugation and ultrasonication and yields highly pure fibrils from AD patients and AD model brain tissues. Mass spectrometry (MS)-based bottom-up proteomic analysis of the purified material represents a robust strategy to identify nearly all the primary protein components of amyloid fibrils. Previous proteomic studies of proteins in the amyloid coronae have revealed an unexpectedly large and functionally diverse collection of proteins. Notably, after refining the purification strategy, the number of co-purifying proteins was reduced by more than 10-fold, indicating the high purity of the isolated SDS insoluble material. Negative staining and immuno-gold electron microscopy allowed confirmation of the purity of these preparations. Further studies are required to understand the spatial and biological attributes that contribute to the deposition of these proteins into amyloid inclusions. Taken together, this analytical strategy is well-positioned to increase the understanding of amyloid biology.

This biochemical purification method with mass spectrometry-based proteomic analysis facilitates the robust characterization of amyloid fibril cores, which may accelerate the identification of targets for preventing Alzheimer's disease.

טיהור ביוכימי ואפיון פרוטאומי של ליבות פיבריל עמילואידיות מהמוח

Proteinaceous fibrillar inclusions are key pathological hallmarks of multiple neurodegenerative diseases. In the early stages of Alzheimer&#39;s disease ...

Isolation of Amyloid Fibrils from Brain Tissue Extract

Source: Upadhyay, A. et al., <a href="https://app.jove.com/v/63816">Biochemical Purification and Proteomic Characterization of Amyloid Fibril Cores from the Brain.</a> J. Vis. Exp. (2022)
This video demonstrates the protocol for isolating&#160; amyloid fibrils from mouse brain tissue extract using density gradient centrifugation and digestion of non-amyloid proteins.

All procedures involving animal samples have been reviewed and approved by the appropriate animal ethical review committee.
1. Tissue harvesting and ...

טיהור וקפל שוב לעמילואיד סיבים של (שלו)

Summary

Explore More Videos