The authors would like to acknowledge Natalie Doude and David Westerway (University of Alberta) for providing us Sho cDNA, Christophe Chevalier (INRA) for plasmid construction, Michel Br&#233;mont (INRA) for providing us BL21Sol bacteria; Christine Longin (INRA) for TEM assistance and Edith Pajot-Augy (INRA) for comments and proofreading.

플라스미드 및 Shadoo 식의 1 세대 주 : 유전자 부호화 뮤린 Shadoo 단백질 (Shadoo 25부터 1백22까지)를 발현 벡터를 pET-28 (11)에 서브 클로닝 하였다. 이 클론은 E.으로 변화되었다 앞서 설명한 바와 같이 11 대장균 N 말단 헥사 히스티딘 태그 (HHHHHHHHHHSSGHIDDDDKHMKGGRGGARGSARGVRGGARGASRVRVRP APRYGSSLRVAAAGAAAGAAAGVAAGLATGSGWRRTSGPGELGLEDDENGAMGGNGTDRGVYSYWAWTSG)와 Shadoo 단백질을 발현하는 균주를 SoluBL21. 플라스미드는 저자에서 요청하실 수 있습니다. 그 아미노산 서열로부터 계산 Shadoo의 분자량은 12,243.2 다이다. 참고 : laminal 흐름 후드 아래에 또는 가까운 분젠 화염에 세균 모든 조작을 수행합니다. <ol><li> 표준 열 쇼크 프로토콜을 사용하여 pET-28-그의 6 -Shadoo 플라스미드 유능한 SoluBL21 박테리아 변환. 플라스미드 1~5 μL이 믹스 (전형적으로 10 내지 100 PG튜브에서 박테리아의 50 μL로 NG). 45 초 동안 42 ℃에서 열 쇼크를 수행한다. </li><li> 배양은 40 ㎎ / ㎖ 카나마이신 (도 1b)로 보충 된 루리아 - 베르 타니 배지에서 0.5 내지 0.7의 600까지 37 ℃에서 형질 전환 된 박테리아. </li><li> 배양에 240 μg의 / ㎖ 이소 프로필 β-D- 티오 갈 락토 피 라노 시드, ITPG를 첨가하여 Shadoo 발현 O / N을 유도한다. 37 ° C에서 150 rpm으로 진탕 배양 균. 참고 : 일반적으로 박테리아 문화가 600 3 O / N의 도달한다. 주 : 형질 전환 박테리아 단백질 생산 미래 -80 ℃에서 저장 될 수있다. 이를 위해, 세균 배양 씩에 10 % -50 % (v / v)의 멸균 글리세롤을 추가하고 -80 ° C에서 그들을 동결. </li></ol><img alt="그림 1" src="/files/ftp_upload/53432/53432fig1.jpg" /> Shadoo 표현의 Shadoo 식 구조, 박테리아의 변화와 유도의 그림 1. 제도 (로 1 단계에서 설명). </stroNG&gt; (A) Shadoo 대한 발현 구성체는 단백질, NT를 N 말단에 융합 헥사 히스티딘 태그를 암호화한다. 방식 Shadoo 단백질이 C 말단 (CT) 다음에 기본 아르기닌 / 글리신 반복 (녹색 실린더), 소수성 도메인 (HD) 및 단일 N 글리코 실화 부위 (CHO)를 포함하고 있음을 보여준다. (B) 애완 동물 (28) - 그의 6 -Shadoo 플라스미드는 42 ℃에서 45 초간 열 충격에 의해 SoluBL21 박테리아로 변환됩니다. 형질 전환 된 박테리아는 선택적 한천 / ㎖ 카나마이신 40 μg의를 포함에 도금되어있다. 플레이트에서 단일 콜로니는 1,000-3,000 ml의 통 플라스크에 문화를 접종하는 데 사용됩니다. 재조합 단백질의 발현이 1 mM의 IPTG로 유도된다. <a href="https://www.jove.com/files/ftp_upload/53432/53432fig1highres.jpg" target="_blank">이 그림의 더 큰 버전을 보려면 여기를 클릭하십시오.</a> 저압 액체 크로마토 Shadoo 단백질 2. 그래피 (LPLC) <ol><li> 세포 용해 및 Inclusion 기관 준비 <ol><li> 세균 현탁액을 수집하고 원심 분리 튜브 (그림 2)로 전송합니다. </li><li> 4 ℃에서 20 분 동안 2,500 XG에 스핀. 경사 및 세포 배양의 500 ml의에서 파생 된 각각의 펠릿에 대한 재현 탁 펠렛 (항 단백 분해 효소 칵테일 50 mM 트리스, 10 mM의 EDTA, pH를 8) 15 ml의 버퍼에 의해 상층 액을 제거합니다. 주 : 펠릿을 재현 탁시키고 동결 며칠 동안 -20 ℃에서 저장 될 수있다. 냉동은 박테리아 세포 용해를 용이하게한다. </li><li> SDS-PAGE 분석 및 쿠마 염색으로 원유 세균 펠릿을 사용하여 재조합 단백질의 과발현을 확인합니다. <ol><li> 이를 위해, 세균 배양의 원심 분리기 1 ml의 세포 펠렛합니다. 5 분 동안 100 ° C에서 100 μL 램 믈리 변성 펠렛 솔루션 (277.8 mM 트리스 - 염산, pH가 6.8, 4.4 % SDS, W 44.4 % / V 글리세롤, 블루 0.02 % 브로 모 페놀)와 열을 추가합니다. </li><li> 12 % 아크릴 아마이드 겔에 부하 시료 10 μL를 실행 SDS-PAGE 및 VISUALIZE은 쿠마시 염색으로 단백질을 분리 하였다. </li></ol></li><li> ) 2.1.2에서 완전히 재 부유 펠릿에 0.5 % 최종 농도 트리톤 X-100을 추가합니다. </li><li> 30 분 동안 37 ℃ 수욕 중에서 현탁 배양한다. </li><li> 세균 세포를 용해시키기 위해 빙 냉수에 6-12 미크론에서 피크 - 투 - 피크 진폭을 5 분 동안 초음파 처리 현탁액. </li><li> 전송 깨끗한 50 ㎖ 원심 분리 튜브에 서스펜션을 초음파. </li><li> 4 ℃에서 15 분 동안 15,000 XG에 원심 분리기 튜브. </li><li> 경사 분리하여 상층 액을 제거하고 튜브 당 결합 완충액 (20 mM Tris-HCl 완충액, pH 7.4의 0.5 M의 NaCl, 8 M 우레아, 5 mM의 이미 다졸) 5 mL를 추가한다. </li><li> 회전 바퀴 O / N에 장소 튜브가 완전히 봉입체에서 단백질을 재현 탁합니다. </li></ol><img alt="그림 2" src="/files/ftp_upload/53432/53432fig2.jpg" /> 포함의 정제의 그림 2. 계획Shadoo 발현 체 (단계 2.1에 기재된 바와 같이). 형질 전환 된 박테리아를 원심 분리에 의해 수확하고 용해 완충액에 재현 탁된다. 현탁액을 30 분 동안 37 ° C에서 배양 한 후, 세균 세포를 기계적으로 파괴하는 초음파 처리된다. 초음파 처리는 시료의 가열을 방지하는 얼음에 행해진 다. 깨진 세포를 원심 분리에 의해 수확 봉입체에서 단백질을 가용화 8 M 요소를 포함하는 버퍼에 재현 탁하고 있습니다. <a href="https://www.jove.com/files/ftp_upload/53432/53432fig2highres.jpg" target="_blank">이 그림의 더 큰 버전을 보려면 여기를 클릭하십시오.</a> </li><li> 니켈 2+ - 친 화성 크로마토 그래피 주 : 크로마토 그래피 5 ㎖ 킬레이트 세 파로스 칼럼 (도 3a), 니켈 2+ -charged 이용한 FPLC 시스템에서 수행된다. 모든 용액 / 분으로 1 ml의 유속으로 컬럼에 로딩된다. <ol><li> 충전하기 위해 세 파로스 칼럼에 0.2 M 니소 4 수용액 10 ㎖를 주입니켈 2 + -ions와. </li><li> 이미 다졸의 낮은 농도 (20 mM Tris-HCl 완충액, pH 7.4의 0.5 M의 NaCl, 8 M 우레아, 5 mM의 이미 다졸)을 함유하는 결합 완충액 중 30 ~ 50 ml를 주입함으로써 니켈 2+ -ions 충전 칼럼을 평형화. </li><li> 50 ml를 주입 루프 요소 - 용해 단백질을로드합니다. </li><li> 완전히 결합되지 않은 단백질의 최대 값을 제거하기 위하여 10 ml의 낮은 다졸 결합 완충액 (20 mM Tris-HCl 완충액, pH 7.4의 0.5 M의 NaCl, 8 M 우레아, 5 mM의 이미 다졸)으로 컬럼을 세척하여 관류 분획을 회수 열에서. </li><li> (mM 트리스 -HCl, pH 7.4, 0.5 M의 NaCl, 8 M 우레아, 80 mM의 이미 다졸 20) 비특이적으로 컬럼에 결합 된 단백질을 용출 세척 완충액 중 50 ~ 100 ㎖로 칼럼을 세척 하였다. </li><li> 20 mM 트리스 - 염산, pH 7.4의 0.5 M의 NaCl, 8 M 우레아를 함유하는 완충액에 80에서 8백까지 mM의 이미 다졸을 15 분 선형 구배를 적용. 그라데이션 적용하는 동안 1 ml의 분수를 수집합니다. 참고 : 그의 - 태그 - 단백질은 재치 용출(경쟁자로 사용) 이미 다졸 함유 버퍼의 하 구배. </li><li> (2.1.3.1 참조) 각 부분의 8 μL 나누어지는을 가지고 4 μL 배 램 믈리 변성 솔루션을 추가 할 수 있습니다. 5 분 동안 100 ℃에서 열 솔루션. </li><li> 부하 쿠마시 염색으로 단백질 크기 마커 10 μL 및 12 % 아크릴 아미드 겔에 각 시료 10㎕를 실행 SDS-PAGE 분리 및 가시화 단백질. 주 : 계산 Shadoo의 분자량은 그것의 아미노산 서열이다 형성 12,243.2 다. </li><li> 풀 Shadoo를 포함하는 모든 분획. </li></ol><img alt="그림 3" src="/files/ftp_upload/53432/53432fig3.jpg" /> (단계 2.2에서 2.4 사이의 설명 참조) 3. 정제 절차도. (A)의 Ni 2+ -ions은 폴리 히스티딘 - 태그 된 단백질의 정제를 허용 선택적 히스티딘 잔기에 의해 조정될 수있다. 이미 다졸을 통해 단백질을 용출하는데 사용된다니켈 - 이온 2+로 조정하고 결합 된 단백질을 대체 할 수있는 능력. (B) 크기 배제 칼럼 상으로 분리되어 A 행의 Ni 2+에 보유 된 다양한 유체 역학적 반경의 단백질. 단백질이 작은 사람에게 가장 큰에서 용출된다. (C)를 ​​사용하기 전에, Shadoo을 포함하는 분획을 모으고 요소, 이미 다졸 및 염을 제거하는 탈염된다. 품질 관리 분석은 SDS-PAGE / 쿠마 염색, 웨스턴 블로 팅을 포함한다. 정제 Shadoo은 동결 건조 할 수있다. -20 ° C에서 저장 될 때 동결 건조 Shadoo 달 동안 안정하다. <a href="https://www.jove.com/files/ftp_upload/53432/53432fig3highres.jpg" target="_blank">이 그림의 더 큰 버전을 보려면 여기를 클릭하십시오.</a> </li><li> 크기 배제 크로마토 그래피 주 : 초 정제 단계가 다른 단백질 제 정제 공정 중에 공동으로부터 용출 Shadoo 단백질을 분리하는 크기 배제 크로마토 그래피로 이루어져(그림 3B). <ol><li> 1.5 ㎖ / 분의 유속으로 20 mM Tris-HCl 완충액, pH 7.4의 0.5 M의 NaCl, 8 M 우레아 250㎖를 주입함으로써 전체 베드 부피 120 ㎖가 슈퍼 덱스 컬럼을 평형화. </li><li> 평형 열 2.2.9에서 Shadoo를 포함하는 부하 풀링 분수. 위의 버퍼의 일정한 흐름에 따라 40 ml를 열 공극 부피 후 1 ml의 분수를 수집합니다. </li><li> 각 부분의 10 μL 나누어지는을 가지고 분수가 Shadoo를 포함하는 알 상술 한 바와 같이 SDS-PAGE 분석 및 쿠마 염색을 수행합니다. </li><li> Shadoo를 포함하는 풀 분수. </li></ol></li><li> 탈염 주 : 탈염 과정은 또한 생물 물리학 적 및 생화학 적 연구 (도 3c)에 적합한 완충액 Shadoo 재조합 단백질을 얻기 위해 염, 이미 다졸 및 우레아를 제거한다. 동일한 결과를 버퍼에 대하여 투석 샘플을 얻을 수있다. <ol><li> 150 ml의 53 ML의 탈염 열 평형/ 분 5 ㎖의 유속으로 10mM의 아세트산 암모늄 완충액, pH가 5의. </li><li> 로드 열 Shadoo 분획을 풀링. 아세트산 암모늄 완충액의 주입시 수동 UV 검출기의 출력에서​​의 280 nm에서 신호의 증가를 보여 분획을 수집한다. </li><li> 동결 건조 탈염 Shadoo을 -20 ℃에서 보관하십시오. </li><li> 적절한 버퍼 내의 동결 건조 Shadoo 같은 된 10 mM 아세트산 나트륨 완충액, pH가 5를 용해, 종래 사용하기. 주 : 폴리 히스티딘 태그는 엔테로 키나제로 제거 할 수있다. </li></ol></li></ol> 생리 학적 pH에서 아밀로이드 피 브릴에 Shadoo의 체외 조립 (3) 주 : 자발적으로 Shadoo 단백질 집계 및 pH를 ≥ 7 (11)에서 섬유를 형성한다. <img alt="그림 4" src="/files/ftp_upload/53432/53432fig4.jpg" /> Shadoo이 아밀로이드 원 섬유에 접힘 그림 4. 제도 (descri로떨고있는 동안 산성 용액에서의 pH ≥ (7)의 버퍼에 용해 할 때 3 단계에서 침대). 정제 Shadoo 자발적 아밀로이드 원 섬유로 변환, Shadoo 1 M GDN-HCl로 배양에 아밀로이드 원 섬유로 변환합니다. 품질 관리 분석 전자 현미경과 THT ​​염색을 포함한다. <a href="https://www.jove.com/files/ftp_upload/53432/53432fig4highres.jpg" target="_blank">이 그림의 더 큰 버전을 보려면 여기를 클릭하십시오.</a> <ol><li> 20 mM Tris-HCl 완충액, pH 7.4의 2 μM의 최종 농도로 희석 Shadoo. 280 nm에서의 용액의 흡광도를 측정하고 20,970의 Shadoo 아미노산 조성물로부터 추론 흡광 계수를 이용하여 농도를 측정한다. </li><li> 아밀로이드 구조 (그림 4)에 자연 단백질 변환을 할 수 있도록, 몇 주 4 ℃에서 원뿔형 플라스틱 튜브에 용액 500 μl를 품어. </li><li> 갓 최종 conce에 T (THT) thioflavin 준비 추가Shadoo 용액 100 μL 분취 10 μM의 ntration. RT에서 5 분 동안 용액을 배양한다. 아밀로이드 구조 (17)의 존재를 확인하는 435 나노 미터의 여기 파장을 사용하여 460에서 520 nm의 형광 발광을 측정한다. </li></ol> 산성 pH 값에서 아밀로이드 피 브릴에 Shadoo의 체외 조립 4. <ol><li> 2 μM의 최종 농도 1 M GdnHCl, 20 mM의 나트륨 아세테이트 완충액, pH를 5로 희석 Shadoo. </li><li> 를 3-7 일 동안, 37 ℃에서 연속 진탕 원추형 튜브 용액 500 μl를 배양한다. </li><li> 3.3에서와 같이 용액의 분취 량을 첨가하여 THT 아밀로이드 피 브릴의 존재를 확인한다. </li><li> Shadoo 아밀로이드 피 브릴를 정화, 10 mM의 나트륨 아세테이트 완충액, pH 5.0으로 대해 얻어진 현탁액을 투석. </li><li> 4 ℃에서 정제 섬유를 저장합니다. </li></ol><img alt="그림 5" src="/files/ftp_upload/53432/53432fig5.jpg"/&gt; 니켈 2+으로부터 용출도 5 대표 결과. 단백질 분획 킬레이트 컬럼 (A)와 크기 배제 컬럼 (B) SDS-PAGE 및 쿠마시 염색을 이용하여 분석을 하였다 -charged. 정제 Shadoo의 식별이 SPRN 방지 Shadoo 항체 (C)를 ​​사용하여 평가 하였다. <a href="https://www.jove.com/files/ftp_upload/53432/53432fig5large.jpg" target="_blank">이 그림의 더 큰 버전을 보려면 여기를 클릭하십시오.</a>

<ol>
	<li>Biasini, E., Turnbaugh, J. A., Unterberger, U., Harris, D. A. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Prion+protein+at+the+crossroads+of+physiology+and+disease.">Prion protein at the crossroads of physiology and disease.</a> Trends in Neurosciences. 35, 92-103 (2012).</li><li>Colby, D. W., Prusiner, S. B. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=De+novo+generation+of+prion+strains.">De novo generation of prion strains.</a> Nature Reviews. Microbiology. 9, 771-777 (2011).</li><li>Chiti, F., Dobson, C. M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Protein+misfolding,+functional+amyloid,+and+human+disease.">Protein misfolding, functional amyloid, and human disease.</a> Annual Review of Biochemistry. 75, 333-366 (2006).</li><li>Nelson, R., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Structure+of+the+cross-beta+spine+of+amyloid-like+fibrils.">Structure of the cross-beta spine of amyloid-like fibrils.</a> Nature. 435, 773-778 (2005).</li><li>Murphy, R. M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Kinetics+of+amyloid+formation+and+membrane+interaction+with+amyloidogenic+proteins.">Kinetics of amyloid formation and membrane interaction with amyloidogenic proteins.</a> Biochimica et Biophysica Acta. 1768, 1923-1934 (2007).</li><li>Steunou, S., Chich, J. F., Rezaei, H., Vidic, J. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Biosensing+of+lipid-prion+interactions:+insights+on+charge+effect,+Cu(II)-ions+binding+and+prion+oligomerization.">Biosensing of lipid-prion interactions: insights on charge effect, Cu(II)-ions binding and prion oligomerization.</a> Biosensors &amp; Bioelectronics. 26, 1399-1406 (2010).</li><li>Watts, J. C., Westaway, D. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+prion+protein+family:+diversity,+rivalry,+and+dysfunction.">The prion protein family: diversity, rivalry, and dysfunction.</a> Biochimica et Biophysica Acta. 1772, 654-672 (2007).</li><li>Westaway, D., Daude, N., Wohlgemuth, S., Harrison, P. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+PrP-like+proteins+Shadoo+and+Doppel.">The PrP-like proteins Shadoo and Doppel.</a> Topics in Current Chemistry. 305, 225-256 (2011).</li><li>Baillod, P., Garrec, J., Tavernelli, I., Rothlisberger, U. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Prion+versus+doppel+protein+misfolding:+new+insights+from+replica-exchange+molecular+dynamics+simulations.">Prion versus doppel protein misfolding: new insights from replica-exchange molecular dynamics simulations.</a> Biochemistry. 52, 8518-8526 (2013).</li><li>Daude, N., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Wild-type+Shadoo+proteins+convert+to+amyloid-like+forms+under+native+conditions.">Wild-type Shadoo proteins convert to amyloid-like forms under native conditions.</a> Journal of Neurochemistry. 113, 92-104 (2010).</li><li>Li, Q., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Shadoo+binds+lipid+membranes+and+undergoes+aggregation+and+fibrillization.">Shadoo binds lipid membranes and undergoes aggregation and fibrillization.</a> Biochemical and Biophysical Research Communications. 438, 519-525 (2013).</li><li>Watts, J. C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+CNS+glycoprotein+Shadoo+has+PrP(C)-like+protective+properties+and+displays+reduced+levels+in+prion+infections.">The CNS glycoprotein Shadoo has PrP(C)-like protective properties and displays reduced levels in prion infections.</a> The EMBO Journal. 26, 4038-4050 (2007).</li><li>Watts, J. C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Protease-resistant+prions+selectively+decrease+Shadoo+protein.">Protease-resistant prions selectively decrease Shadoo protein.</a> PLoS Pathogens. 7, e1002382 (2011).</li><li>Westaway, D., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Down-regulation+of+Shadoo+in+prion+infections+traces+a+pre-clinical+event+inversely+related+to+PrP(Sc)+accumulation.">Down-regulation of Shadoo in prion infections traces a pre-clinical event inversely related to PrP(Sc) accumulation.</a> PLoS Pathogens. 7, e1002391 (2011).</li><li>Chevalier, C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=PB1-F2+influenza+A+virus+protein+adopts+a+beta-sheet+conformation+and+forms+amyloid+fibers+in+membrane+environments.">PB1-F2 influenza A virus protein adopts a beta-sheet conformation and forms amyloid fibers in membrane environments.</a> The Journal of Biological Chemistry. 285, 13233-13243 (2010).</li><li>Tarus, B., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Oligomerization+paths+of+the+nucleoprotein+of+influenza+A+virus.">Oligomerization paths of the nucleoprotein of influenza A virus.</a> Biochimie. 94, 776-785 (2012).</li><li>Biancalana, M., Koide, S. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Molecular+mechanism+of+Thioflavin-T+binding+to+amyloid+fibrils.">Molecular mechanism of Thioflavin-T binding to amyloid fibrils.</a> Biochimica et Biophysica Acta. 1804, 1405-1412 (2010).</li><li>Minic, J., Sautel, M., Salesse, R., Pajot-Augy, E. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Yeast+system+as+a+screening+tool+for+pharmacological+assessment+of+g+protein+coupled+receptors.">Yeast system as a screening tool for pharmacological assessment of g protein coupled receptors.</a> Current Medicinal Chemistry. 12, 961-969 (2005).</li><li>Schein, C. H. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=A+cool+way+to+make+proteins.">A cool way to make proteins.</a> Nature Biotechnology. 22, 826-827 (2004).</li><li>Sorensen, H. P., Mortensen, K. K. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Advanced+genetic+strategies+for+recombinant+protein+expression+in+Escherichia+coli.">Advanced genetic strategies for recombinant protein expression in Escherichia coli.</a> Journal of Biotechnology. 115, 113-128 (2005).</li><li>Zhang, J., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Disruption+of+glycosylation+enhances+ubiquitin-mediated+proteasomal+degradation+of+Shadoo+in+Scrapie-infected+rodents+and+cultured+cells.">Disruption of glycosylation enhances ubiquitin-mediated proteasomal degradation of Shadoo in Scrapie-infected rodents and cultured cells.</a> Molecular Neurobiology. 49, 1373-1384 (2014).</li><li>Englund, P. T. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+structure+and+biosynthesis+of+glycosyl+phosphatidylinositol+protein+anchors.">The structure and biosynthesis of glycosyl phosphatidylinositol protein anchors.</a> Annual Review of Biochemistry. 62, 121-138 (1993).</li><li>Puig, B., Altmeppen, H., Glatzel, M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+GPI-anchoring+of+PrP:+implications+in+sorting+and+pathogenesis.">The GPI-anchoring of PrP: implications in sorting and pathogenesis.</a> Prion. 8, 11-18 (2014).</li></ol>

The authors have nothing to disclose.

발현 및 재조합 마우스 Shadoo 단백질의 다량의 정제 모두에 대한 쉽고 효율적인 프로토콜이 제시된다. 기재된 방법은 성공적인 가용화 및 (그의 6) -tagged Shadoo 재조합 단백질을 정제 할 수있다. 제목에서 지적했듯이 그것은 중요하다 원핵 박테리아 E. 표현하는 경우 대장균 Shadoo은 봉입체에 축적. Shadoo 정제에 앞서, 박테리아는 트리톤 X-100을 함유하는 완충액에 용해하여 초음?...

인간의 양 및 크로이츠 펠트 - 야콥병에서 소 해면상 소에서 뇌, 스크래피를 포함 프리온 신경 퇴행성 질환은 치명적 및 불치이다. 프리온 질병은 주로 가교 β 시트로, α-나선 이루어지는 세포 프리온 단백질의 형태 적 변화에 의해 특징 1,2- 콘 포머 (conformer) 아밀로이드 농후. 크로스 - β-구조는 조밀 포함 높은 순서 결정과 같은 β-시트는 수소 결합 3,4 안정화. 프리온 아밀로이드 모집에 대한 템플릿을 제공하고 단량체 단백질 변환 부 성장 가장자리에 β-가닥에 의한 자기 복제를 할 수 있습니다. &quot;단백질 만&quot;가설에 따르면, 프리온 단백질 아밀로이드 콘 포머 (conformer)가 단독 감염원이다. 그러나, 일부 다른 생체 분자 프리온 질환에 필수적인 것으로 제안되어있다. 예를 들어, 세포막 곳 어디 conversi 것으로 생각되고켜짐 일어나며 일부 음으로 하전 된 지질은 변환 처리 5,6-을 강화하는 것으로 나타났다. 또한, 일부 단백질은 또한 프리온 병리에 관여 할 수있다. Doppel 및 Shadoo 7,8 : 특히, 프리온 단백질 가족의 다른 두 멤버가있다. Doppel는 디 황화 다리와 안정 상대적으로 견고한 구조를 가지고 있으며, 아밀로이드 원 섬유 (9)에 자기 중합 집계에 실패합니다. 반면, 프리온 단백질과 유사하게, Shadoo 아밀로이드 피 브릴 구조로 β 시트 - 풍부 구조의 자기 준을 채택 할 수있다. 그것은 Shadoo가 기본 조건 또는 음전하 막 10, 11 바인딩에 피 브릴 수있는 것으로 나타났다. 아밀로이드 섬유 형상으로의 변환은 Shadoo 병리와 연관 될 수있다. 실제로, 아밀로이드 형 구조는 질병을 야기하는 메커니즘이 제대로 이해된다. Shadoo은 소수성 도메인 (HD)와 직렬의 Arg / 대 Gly 맺는 일련의 유사한 반복 t프리온 단백질 (도 1a)의 N- 말단 부분 O. 프리온 단백질의 N 말단 부분으로서, Shadoo 매우 양전하와 기본적으로 구조화 단백질 11,12 것으로 나타나고있다. 직접적 프리온 단백질에 결합 할 수 있기 때문에 Shadoo 프리온 질환과 기능적으로 관련이있을 것 같다. 또한, 그것의 발현은 다운 프리온 병리학 13,14 동안 조절된다. 그러나 프리온 질환에 Shadoo의 역할은 아직 확립되어 있지 않습니다. 우리는 마우스 Shadoo 유전자의 코딩 서열을 운반하는 플라스미드를 개발 하였다. E. 플라스미드를 형질 전환시켰다 대장균 N- 말단 그의 6 융합 Shadoo 단백질의 생산. 이 발현 시스템은 잘 우리의 실험실에 설립되어 일반적으로 우리의 진행하는 프로젝트 6,15,16에 사용됩니다. Shadoo의 표현을위한 중요한 문제는 E.의 선택 대장균 균주. 유능한 BL21 균주는 일반적으로 재조합 프로의 표현에 사용되는 동안teins Shadoo 성공적으로 표현하고 변환 된 SoluBL21 균주에서만 정제 하였다. SoluBL21 관할 E. 대장균 발현 상위 BL21에서 검출 가능한 가용성 생성물을 수득되지 단백질의 생산을 위해 개발 BL21의 숙주 균주의 개선 돌연변이이다. SoluBL21 E.에서 Shadoo의 높은 수준의 표현 대장균 봉입체에서 단백질의 축적에 이르게. 비 - 천연 단백질은 E. 고도로 표현된다 일반적인 기능뿐만 대장균은,이 단백질은 불용성 봉입체에 축적되는 경향이있다. Shadoo 아마 여러도에 접힌 단백질에 의해 형성 고농축 동적 구조 비공유 소수성 또는 이온의 상호 작용 (또는이 둘의 조합)을 통해 집계합니다. (I) 변성 매체로부터 다른 생체 단백질의 선택적 분리, (ⅱ) 정제 된 단백질의 탈 변성 시험 관내 폴딩에 사용 : 결과적으로, 정제는 적어도 두 개의 단계를 포함기법. Shadoo의 선택적 분리는 8M 우레아 (또는 대안 6M 염산 구아니딘)를 함유하는 완충액에 달성되었다. (ⅰ) 탈 변성을 산성 pH의 용액에서 Shadoo의 중합을 수득하여 pH ≥의 용액 7 비정형 단량체 Shadoo 단백질, 또는 (ⅱ) 탈 변성을 얻었다 : 우레아 및 제거 단백질의 탈 변성은 다양한 프로토콜을 적용하여 수행 할 수있다 특성 크로스 - β 시트 모티브와 안정 아밀로이드 섬유로.

<table>
	<tbody>
		<tr>
			<td>AKTA FPLC&#160;</td>
			<td>GE, Amersham</td>
			<td># 1363</td>
			<td></td>
		</tr>
		<tr>
			<td>HiLoad 16/60 Superdex</td>
			<td>GE Healthcare</td>
			<td>17-1069-01</td>
			<td></td>
		</tr>
		<tr>
			<td>HiTrap IMAC</td>
			<td>GE Healthcare</td>
			<td>GE17-0920-05</td>
			<td></td>
		</tr>
		<tr>
			<td>HiPrep26/10 Desalting column</td>
			<td>GE Healthcare</td>
			<td>GE17-5087-01</td>
			<td></td>
		</tr>
		<tr>
			<td>SoluBL21 Competent E. coli</td>
			<td>Genlantis</td>
			<td>C700200</td>
			<td></td>
		</tr>
		<tr>
			<td>pET-28b+</td>
			<td>Novogen</td>
			<td>69865-3</td>
			<td></td>
		</tr>
		<tr>
			<td>IPTG</td>
			<td>Sigma-Aldrich</td>
			<td>I6758</td>
			<td></td>
		</tr>
		<tr>
			<td>LB-Broth medium</td>
			<td>Sigma-Aldrich</td>
			<td>L3022</td>
			<td></td>
		</tr>
		<tr>
			<td>Eppendorf Biophotometar</td>
			<td>Eppendorf</td>
			<td>550507804</td>
			<td></td>
		</tr>
		<tr>
			<td>Trito X-100</td>
			<td>Life Technologies</td>
			<td>85111</td>
			<td></td>
		</tr>
		<tr>
			<td>NiSO4</td>
			<td>Sigma-Aldrich</td>
			<td>656895</td>
			<td></td>
		</tr>
		<tr>
			<td>EDTA</td>
			<td>Sigma-Aldrich</td>
			<td>E6758</td>
			<td></td>
		</tr>
		<tr>
			<td>Tris-HCl</td>
			<td>Sigma-Aldrich</td>
			<td>RES3098T</td>
			<td></td>
		</tr>
		<tr>
			<td>Protease Inhibitor Cocktail Tablets</td>
			<td>Roche</td>
			<td>4693116001</td>
			<td></td>
		</tr>
		<tr>
			<td>NaCl</td>
			<td>Sigma-Aldrich</td>
			<td>746398</td>
			<td></td>
		</tr>
		<tr>
			<td>Imidazol</td>
			<td>Sigma-Aldrich</td>
			<td>I5513</td>
			<td></td>
		</tr>
		<tr>
			<td>Gdn-HCl</td>
			<td>Sigma-Aldrich</td>
			<td>G4505</td>
			<td></td>
		</tr>
		<tr>
			<td>protein size marker&#160;</td>
			<td>Thermo Fisher Scientific</td>
			<td>26620</td>
			<td></td>
		</tr>
	</tbody>
</table>

purification and refolding to amyloid fibrils of (his)6-tagged recombinant shadoo protein expressed as inclusion bodies in e. coli

대장균 발현 시스템은 재조합 진핵 단백질의 생산을위한 강력한 도구이다. 우리는 Shadoo, 프리온 가족에 속하는 단백질을 생산하기 위해 사용합니다. 봉입체 설명 된 바와 같이 (그의) 6 -tagged 재조합 Shadoo의 정제를위한 크로마토 그래피 방법을 표현했다. 봉입체는 8 M 유레아에 용해하고 이온 친 화성 크로마토 그래피를 수행하는 니켈 2+ -charged 칼럼에 결합된다. 결합 된 단백질은 이미 다졸 구배로 용출된다. Shadoo 단백질을 함유하는 분획을 고도로 정제 된 단백질을 수득하는 크기 배제 크로마토 그래피를 실시한다. 마지막 단계 정제 Shadoo에서 염, 우레아 및 이미 다졸을 제거하는 탈염된다. 재조합 Shadoo 단백질 프리온 질환에서 발생하는 단백질의 입체 장애의 생물 물리학 및 생화학 연구를위한 중요한 시약이다. 대부분의 보고서는 프리온 신경 퇴행성 질환이 자상의 증착에서 발생한 것을 증명제작은 아밀로이드 원 섬유를 주문했다. 산성 및 중성에서 아밀로이드 원 섬유로 Shadoo을 피 브릴하는 방법을 설명하는 샘플 프로토콜 / 기본 pH 값이 표시됩니다. 생산하고 신속하고 저렴한 비용으로 단백질의 대량 생산이 가능하기 때문에 Shadoo은, 프리온 질환에 작업 실험실에서 연구를 용이하게 할 수있다 피 브릴하는 방법에 대한 방법.

정제 Shadoo 단백질의 5-10 mg의 세균 배양 리터당 얻어진다. 두 단계의 정제는 고순도의 재조합 Shadoo을 구하는데 필요하다. 첫 번째 단계는 그의 - 태그 - 단백질을 유지하는 니켈 2 + -charged 컬럼 친 화성 크로마토 그래피에 의해 수행된다. 용출 분획을 SDS-PAGE를 실시하고 쿠마 브릴리언트 블루 (그림 5A)로 염색한다. Shadoo 단백질을 함유하는 분획을 모으고 또한 그 크기에 따라 분?...

Watch this Scientific Journal Video about Purification and Refolding to Amyloid Fibrils of His6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli at JoVE.com

Purification and Refolding to Amyloid Fibrils of His6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli

A two-step chromatographic method is described for the purification of recombinant Shadoo protein expressed as inclusion bodies in Escherichia coli, as well as a protocol to fibrillate purified Shadoo into amyloid structures.

정제 및 아밀로이드 피 브릴로 리 폴딩 (그의)<sub&gt; 6</sub&gt; -tagged 재조합 Shadoo 단백질의 봉입체로 표현<em&gt; 대장균</em

The Escherichia coli expression system is a powerful tool for the production of recombinant eukaryotic proteins. We use it to produce Shadoo, a protein ...

purification-refolding-to-amyloid-fibrils-his6-tagged-recombinant

Research

JoVE Journal

Biology

Purification and Refolding to Amyloid Fibrils of (His)6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli

14.1K 조회수.  INRA. A two-step chromatographic method is described for the purification of recombinant Shadoo protein expressed as inclusion bodies in Escherichia coli, as well as a protocol to fibrillate purified Shadoo into amyloid structures. 

비디오: Purification and Refolding to Amyloid Fibrils of His6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli

Patch Clamp Recording of Ion Channels Expressed in  Xenopus Oocytes

Since its development by Sakmann and Neher 1, 2, the patch clamp has become established as an extremely useful technique for electrophysiological measurement of single or multiple ion channels in cells. This technique can be applied to ion channels in both their native environment and expressed in heterologous cells, such as oocytes harvested from the African clawed frog, Xenopus laevis. Here, we describe the well-established technique of patch clamp recording from Xenopus oocytes. This technique is used to measure the properties of expressed ion channels either in populations (macropatch) or individually (single-channel recording). We focus on techniques to maximize the quality of oocyte preparation and seal generation. With all factors optimized, this technique gives a probability of successful seal generation over 90 percent. The process may be optimized differently by every researcher based on the factors he or she finds most important, and we present the approach that have lead to the greatest success in our hands.

This is intended as an introduction to patch clamp recording from Xenopus laevis oocytes. It covers vitelline membrane removal, formation of a gigaohm seal (gigaseal), and the optional conversion of the patch to the outside-out topology.

Xenopus Oocytes의 표현 이온 채널 패치 클램프 녹음

Since its development by Sakmann and Neher 1, 2, the patch clamp has become established as an extremely useful technique for electrophysiological ...

연구

생물학

Staining of Proteins in Gels with Coomassie G-250 without Organic Solvent and Acetic Acid

In classical protein staining protocols using Coomassie Brilliant Blue (CBB), solutions with high contents of toxic and flammable organic solvents (Methanol, Ethanol or 2-Propanol) and acetic acid are used for fixation, staining and destaining of proteins in a gel after SDS-PAGE. To speed up the procedure, heating the staining solution in the microwave oven for a short time is frequently used. This usually results in evaporation of toxic or hazardous Methanol, Ethanol or 2-Propanol and a strong smell of acetic acid in the lab which should be avoided due to safety considerations. In a protocol originally published in two patent applications by E.M. Wondrak (US2001046709 (A1), US6319720 (B1)), an alternative composition of the staining solution is described in which no organic solvent or acid is used. The CBB is dissolved in bidistilled water (60-80mg of CBB G-250 per liter) and 35 mM HCl is added as the only other compound in the staining solution. The CBB staning of the gel is done after SDS-PAGE and thorough washing of the gel in bidistilled water. By heating the gel during the washing and staining steps, the process can be finished faster and no toxic or hazardous compunds are evaporating. The staining of proteins occurs already within 1 minute after heating the gel in staining solution and is fully developed after 15-30 min with a slightly blue background that is destained completely by prolonged washing of the stained gel in bidistilled water, without affecting the stained protein bands.

A short protocol for protein staining with Coomassie Brilliant Blue (CBB) G-250 in polyacrylamide gels is described without using organic solvents or acetic acid as in the classical staining procedures with CBB.

유기 용매 및 초산없이 쿠매시 G - 250로 젤의 단백질 염색법

In classical protein staining protocols using Coomassie Brilliant Blue (CBB), solutions with high contents of toxic and flammable organic solvents ...

Mutagenesis and Functional Selection Protocols for Directed Evolution of Proteins in E. coli

The efficient generation of genetic diversity represents an invaluable molecular tool that can be used to label DNA synthesis, to create unique molecular signatures, or to evolve proteins in the laboratory. Here, we present a protocol that allows the generation of large (>1011) mutant libraries for a given target sequence. This method is based on replication of a ColE1 plasmid encoding the desired sequence by a low-fidelity variant of DNA polymerase I (LF-Pol I). The target plasmid is transformed into a mutator strain of E. coli and plated on solid media, yielding between 0.2 and 1 mutations/kb, depending on the location of the target gene. Higher mutation frequencies are achieved by iterating this process of mutagenesis. Compared to alternative methods of mutagenesis, our protocol stands out for its simplicity, as no cloning or PCR are involved. Thus, our method is ideal for mutational labeling of plasmids or other Pol I templates or to explore large sections of sequence space for the evolution of activities not present in the original target. The tight spatial control that PCR or randomized oligonucleotide-based methods offer can also be achieved through subsequent cloning of specific sections of the library. Here we provide protocols showing how to create a random mutant library and how to establish drug-based selections in E. coli to identify mutants exhibiting new biochemical activities.

Mutagenesis and Functional Selection Protocols for Directed Evolution of Proteins in E. coli

Here we demonstrate a simple protocol to create a random mutant library for a given target sequence. We show how this method, which is performed in vivo in Escherichia coli, can be coupled with functional selections to evolve new enzymatic activities.

에서 단백질의 감독 진화에 대한 돌연변이 유발 및 기능 선택 프로토콜 E. 대장균</em

The efficient generation of genetic diversity represents an invaluable molecular tool that can be used to label DNA synthesis, to create unique molecular ...

Purification of Hsp104, a Protein Disaggregase

Hsp104 is a hexameric AAA+ protein1 from yeast, which couples ATP hydrolysis to protein disaggregation2-10 (Fig. 1). This activity imparts two key selective advantages. First, renaturation of disordered aggregates by Hsp104 empowers yeast survival after various protein-misfolding stresses, including heat shock3,5,11,12. Second, remodeling of cross-beta amyloid fibrils by Hsp104 enables yeast to exploit myriad prions (infectious amyloids) as a reservoir of beneficial and heritable phenotypic variation13-22. Remarkably, Hsp104 directly remodels preamyloid oligomers and amyloid fibrils, including those comprised of the yeast prion proteins Sup35 and Ure223-30. This amyloid-remodeling functionality is a specialized facet of yeast Hsp104. The E. coli orthologue, ClpB, fails to remodel preamyloid oligomers or amyloid fibrils26,31,32.
Hsp104 orthologues are found in all kingdoms of life except, perplexingly, animals. Indeed, whether animal cells possess any enzymatic system that couples protein disaggregation to renaturation (rather than degradation) remains unknown33-35. Thus, we and others have proposed that Hsp104 might be developed as a therapeutic agent for various neurodegenerative diseases connected with the misfolding of specific proteins into toxic preamyloid oligomers and amyloid fibrils4,7,23,36-38. There are no treatments that directly target the aggregated species associated with these diseases. Yet, Hsp104 dissolves toxic oligomers and amyloid fibrils composed of alpha-synuclein, which are connected with Parkinson's Disease23 as well as amyloid forms of PrP39. Importantly, Hsp104 reduces protein aggregation and ameliorates neurodegeneration in rodent models of Parkinson's Disease23 and Huntington's disease38. Ideally, to optimize therapy and minimize side effects, Hsp104 would be engineered and potentiated to selectively remodel specific aggregates central to the disease in question4,7. However, the limited structural and mechanistic understanding of how Hsp104 disaggregates such a diverse repertoire of aggregated structures and unrelated proteins frustrates these endeavors30,40-42.
To understand the structure and mechanism of Hsp104, it is essential to study the pure protein and reconstitute its disaggregase activity with minimal components. Hsp104 is a 102kDa protein with a pI of ~5.3, which hexamerizes in the presence of ADP or ATP, or at high protein concentrations in the absence of nucleotide43-46. Here, we describe an optimized protocol for the purification of highly active, stable Hsp104 from E. coli. The use of E. coli allows simplified large-scale production and our method can be performed quickly and reliably for numerous Hsp104 variants. Our protocol increases Hsp104 purity and simplifies His6-tag removal compared to a previous purification method from E. coli47. Moreover, our protocol is more facile and convenient than two more recent protocols26,48.

Here, we describe a protocol for the purification of highly active Hsp104, a hexameric AAA+ protein from yeast, which couples ATP hydrolysis to protein disaggregation. This scheme exploits a His6-tagged construct for affinity purification from E. coli followed by anion-exchange chromatography, His6-tag removal with TEV protease, and size-exclusion chromatography.

Hsp104의 정화, 단백질 Disaggregase

Hsp104 is a hexameric AAA+ protein1 from yeast, which couples ATP hydrolysis to protein disaggregation2-10 (Fig. 1). This activity imparts two key ...

Identification of Protein Complexes in Escherichia coli using Sequential Peptide Affinity Purification in Combination with Tandem Mass Spectrometry

Since most cellular processes are mediated by macromolecular assemblies, the systematic identification of protein-protein interactions (PPI) and the identification of the subunit composition of multi-protein complexes can provide insight into gene function and enhance understanding of biological systems1, 2. Physical interactions can be mapped with high confidence vialarge-scale isolation and characterization of endogenous protein complexes under near-physiological conditions based on affinity purification of chromosomally-tagged proteins in combination with mass spectrometry (APMS). This approach has been successfully applied in evolutionarily diverse organisms, including yeast, flies, worms, mammalian cells, and bacteria1-6. In particular, we have generated a carboxy-terminal Sequential Peptide Affinity (SPA) dual tagging system for affinity-purifying native protein complexes from cultured gram-negative Escherichia coli, using genetically-tractable host laboratory strains that are well-suited for genome-wide investigations of the fundamental biology and conserved processes of prokaryotes1, 2, 7. Our SPA-tagging system is analogous to the tandem affinity purification method developed originally for yeast8, 9, and consists of a calmodulin binding peptide (CBP) followed by the cleavage site for the highly specific tobacco etch virus (TEV) protease and three copies of the FLAG epitope (3X FLAG), allowing for two consecutive rounds of affinity enrichment. After cassette amplification, sequence-specific linear PCR products encoding the SPA-tag and a selectable marker are integrated and expressed in frame as carboxy-terminal fusions in a DY330 background that is induced to transiently express a highly efficient heterologous bacteriophage lambda recombination system10. Subsequent dual-step purification using calmodulin and anti-FLAG affinity beads enables the highly selective and efficient recovery of even low abundance protein complexes from large-scale cultures. Tandem mass spectrometry is then used to identify the stably co-purifying proteins with high sensitivity (low nanogram detection limits).
Here, we describe detailed step-by-step procedures we commonly use for systematic protein tagging, purification and mass spectrometry-based analysis of soluble protein complexes from E. coli, which can be scaled up and potentially tailored to other bacterial species, including certain opportunistic pathogens that are amenable to recombineering. The resulting physical interactions can often reveal interesting unexpected components and connections suggesting novel mechanistic links. Integration of the PPI data with alternate molecular association data such as genetic (gene-gene) interactions and genomic-context (GC) predictions can facilitate elucidation of the global molecular organization of multi-protein complexes within biological pathways. The networks generated for E. coli can be used to gain insight into the functional architecture of orthologous gene products in other microbes for which functional annotations are currently lacking.

Identification of Protein Complexes in Escherichia coli using Sequential Peptide Affinity Purification in Combination with Tandem Mass Spectrometry

Affinity purification of tagged proteins in combination with mass spectrometry (APMS) is a powerful method for the systematic mapping of protein interaction networks and for investigating the mechanistic basis of biological processes. Here, we describe an optimized sequential peptide affinity (SPA) APMS procedure developed for the bacterium Escherichia coli that can be used to isolate and characterize stable multi-protein complexes to near homogeneity even starting from low copy numbers per cell.

의 단백질 단지의 식별<em&gt; 대장균</em&gt; 직렬 질량 분석법과 함께 순차적 펩타이드의 동질 정화를 사용하여

Since most cellular processes are mediated by macromolecular assemblies, the systematic identification of protein-protein interactions (PPI) and the ...

Coupled Assays for Monitoring Protein Refolding in Saccharomyces cerevisiae

Proteostasis, defined as the combined processes of protein folding/biogenesis, refolding/repair, and degradation, is a delicate cellular balance that must be maintained to avoid deleterious consequences 1. External or internal factors that disrupt this balance can lead to protein aggregation, toxicity and cell death. In humans this is a major contributing factor to the symptoms associated with neurodegenerative disorders such as Huntington's, Parkinson's, and Alzheimer's diseases 10. It is therefore essential that the proteins involved in maintenance of proteostasis be identified in order to develop treatments for these debilitating diseases. This article describes techniques for monitoring in vivo protein folding at near-real time resolution using the model protein firefly luciferase fused to green fluorescent protein (FFL-GFP). FFL-GFP is a unique model chimeric protein as the FFL moiety is extremely sensitive to stress-induced misfolding and aggregation, which inactivates the enzyme 12. Luciferase activity is monitored using an enzymatic assay, and the GFP moiety provides a method of visualizing soluble or aggregated FFL using automated microscopy. These coupled methods incorporate two parallel and technically independent approaches to analyze both refolding and functional reactivation of an enzyme after stress. Activity recovery can be directly correlated with kinetics of disaggregation and re-solubilization to better understand how protein quality control factors such as protein chaperones collaborate to perform these functions. In addition, gene deletions or mutations can be used to test contributions of specific proteins or protein subunits to this process. In this article we examine the contributions of the protein disaggregase Hsp104 13, known to partner with the Hsp40/70/nucleotide exchange factor (NEF) refolding system 5, to protein refolding to validate this approach.

Coupled Assays for Monitoring Protein Refolding in Saccharomyces cerevisiae

This article describes the use of a firefly luciferase-GFP fusion protein to investigate in vivo protein folding in Saccharomyces cerevisiae. Using this reagent, refolding of a model heat-denatured protein can be monitored simultaneously by fluorescence microscopy and an enzymatic assay to probe the roles of proteostasis network components in protein quality control.

의 모니터링 단백질 접힘에 대한 결합 분석 실험<em&gt; 사카 cerevisiae의</em

Proteostasis, defined as the combined processes of protein folding/biogenesis, refolding/repair, and degradation, is a delicate cellular balance that must ...

Purification of the Cystic Fibrosis Transmembrane Conductance Regulator Protein Expressed in Saccharomyces cerevisiae

Defects in the cystic fibrosis transmembrane conductance regulator (CFTR) protein cause cystic fibrosis (CF), an autosomal recessive disease that currently limits the average life expectancy of sufferers to &#60;40 years of age. The development of novel drug molecules to restore the activity of CFTR is an important goal in the treatment CF, and the isolation of functionally active CFTR is a useful step towards achieving this goal.
We describe two methods for the purification of CFTR from a eukaryotic heterologous expression system, S. cerevisiae. Like prokaryotic systems, S. cerevisiae can be rapidly grown in the lab at low cost, but can also traffic and posttranslationally modify large membrane proteins. The selection of detergents for solubilization and purification is a critical step in the purification of any membrane protein. Having screened for the solubility of CFTR in several detergents, we have chosen two contrasting detergents for use in the purification that allow the final CFTR preparation to be tailored to the subsequently planned experiments.
In this method, we provide comparison of the purification of CFTR in dodecyl-&#946;-D-maltoside (DDM) and 1-tetradecanoyl-sn-glycero-3-phospho-(1&#39;-rac-glycerol) (LPG-14). Protein purified in DDM by this method shows ATPase activity in functional assays. Protein purified in LPG-14 shows high purity and yield, can be employed to study post-translational modifications, and can be used for structural methods such as small-angle X-ray scattering and electron microscopy. However it displays significantly lower ATPase activity.

Purification of the Cystic Fibrosis Transmembrane Conductance Regulator Protein Expressed in Saccharomyces cerevisiae

Heterologous expression and purification of the cystic fibrosis transmembrane conductance regulator (CFTR) are significant challenges and limiting factors in the development of drug therapies for cystic fibrosis. This protocol describes two methods for the isolation of milligram quantities of CFTR suitable for functional and structural studies.&#160;

로 표현 낭포 성 섬유증 막 횡단 전도력 규칙 단백질의 정제<em&gt; 사카로 마이 세스 세레 비시 애</em

Defects in the cystic fibrosis transmembrane conductance regulator (CFTR) protein cause cystic fibrosis (CF), an autosomal recessive disease that ...

High Throughput Quantitative Expression Screening and Purification Applied to Recombinant Disulfide-rich Venom Proteins Produced in E. coli

Escherichia coli (E. coli) is the most widely used expression system for the production of recombinant proteins for structural and functional studies. However, purifying proteins is sometimes challenging since many proteins are expressed in an insoluble form. When working with difficult or multiple targets it is therefore recommended to use high throughput (HTP) protein expression screening on a small scale (1-4&#160;ml cultures) to quickly identify conditions for soluble expression. To cope with the various structural genomics programs of the lab, a quantitative (within a range of 0.1-100 mg/L culture of recombinant protein) and HTP protein expression screening protocol was implemented and validated on thousands of proteins. The protocols were automated with the use of a liquid handling robot but can also be performed manually without specialized equipment.
Disulfide-rich venom proteins are gaining increasing recognition for their potential as therapeutic drug leads. They can be highly potent and selective, but their complex disulfide bond networks make them challenging to produce. As a member of the FP7 European Venomics project (<a href="http://www.venomics.eu">www.venomics.eu</a>), our challenge is to develop successful production strategies with the aim of producing thousands of novel venom proteins for functional characterization. Aided by the redox properties of disulfide bond isomerase DsbC, we adapted our HTP production pipeline for the expression of oxidized, functional venom peptides in the E. coli cytoplasm. The protocols are also applicable to the production of diverse disulfide-rich proteins. Here we demonstrate our pipeline applied to the production of animal venom proteins. With the protocols described herein it is likely that soluble disulfide-rich proteins will be obtained in as little as a week. Even from a small scale, there is the potential to use the purified proteins for validating the oxidation state by mass spectrometry, for characterization in pilot studies, or for sensitive micro-assays.

High Throughput Quantitative Expression Screening and Purification Applied to Recombinant Disulfide-rich Venom Proteins Produced in E. coli

A protocol for the quantitative, high throughput expression screening and analytical purification of fusion proteins from small-scale Escherichia coli cultures is described and applied to the expression of disulfide-rich animal venom protein targets.

에서 생산 재조합 이황화 풍부한 독 단백질에 적용되는 높은 처리량 정량 식 검사 및 정화<em&gt; E. 대장균</em

Escherichia coli (E. coli) is the most widely used expression system for the production of recombinant proteins for structural and functional studies. ...

Non-chromatographic Purification of Recombinant Elastin-like Polypeptides and their Fusions with Peptides and Proteins from Escherichia coli

Elastin-like polypeptides are repetitive biopolymers that exhibit a lower critical solution temperature phase transition behavior, existing as soluble unimers below a characteristic transition temperature and aggregating into micron-scale coacervates above their transition temperature. The design of elastin-like polypeptides at the genetic level permits precise control of their sequence and length, which dictates their thermal properties. Elastin-like polypeptides are used in a variety of applications including biosensing, tissue engineering, and drug delivery, where the transition temperature and biopolymer architecture of the ELP can be tuned for the specific application of interest. Furthermore, the lower critical solution temperature phase transition behavior of elastin-like polypeptides allows their purification by their thermal response, such that their selective coacervation and resolubilization allows the removal of both soluble and insoluble contaminants following expression in Escherichia coli. This approach can be used for the purification of elastin-like polypeptides alone or as a purification tool for peptide or protein fusions where recombinant peptides or proteins genetically appended to elastin-like polypeptide tags can be purified without chromatography. This protocol describes the purification of elastin-like polypeptides and their peptide or protein fusions and discusses basic characterization techniques to assess the thermal behavior of pure elastin-like polypeptide products.

Non-chromatographic Purification of Recombinant Elastin-like Polypeptides and their Fusions with Peptides and Proteins from Escherichia coli

Elastin-like polypeptides are stimulus-responsive biopolymers with applications ranging from recombinant protein purification to drug delivery. This protocol describes the purification and characterization of elastin-like polypeptides and their peptide or protein fusions from Escherichia coli using their lower critical solution temperature phase transition behavior as a simple alternative to chromatography.

에서 펩타이드 및 단백질과 재조합 엘라스틴 같은 폴리 펩타이드 및 그 융해의 비 크로마토 그래피 정제<em&gt; 대장균</em

Elastin-like polypeptides are repetitive biopolymers that exhibit a lower critical solution temperature phase transition behavior, existing as soluble ...

Green Fluorescent Protein-based Expression Screening of Membrane Proteins in Escherichia coli

The production of recombinant membrane proteins for structural and functional studies remains technically challenging due to low levels of expression and the inherent instability of many membrane proteins once solubilized in detergents. A protocol is described that combines ligation independent cloning of membrane proteins as GFP fusions with expression in Escherichia coli detected by GFP fluorescence. This enables the construction and expression screening of multiple membrane protein/variants to identify candidates suitable for further investment of time and effort. The GFP reporter is used in a primary screen of expression by visualizing GFP fluorescence following SDS polyacrylamide gel electrophoresis (SDS-PAGE). Membrane proteins that show both a high expression level with minimum degradation as indicated by the absence of free GFP, are selected for a secondary screen. These constructs are scaled and a total membrane fraction prepared and solubilized in four different detergents. Following ultracentrifugation to remove detergent-insoluble material, lysates are analyzed by fluorescence detection size exclusion chromatography (FSEC). Monitoring the size exclusion profile by GFP fluorescence provides information about the mono-dispersity and integrity of the membrane proteins in different detergents. Protein: detergent combinations that elute with a symmetrical peak with little or no free GFP and minimum aggregation are candidates for subsequent purification. Using the above methodology, the heterologous expression in E. coli of SED (shape, elongation, division, and sporulation) proteins from 47 different species of bacteria was analyzed. These proteins typically have ten transmembrane domains and are essential for cell division. The results show that the production of the SEDs orthologues in E. coli was highly variable with respect to the expression levels and integrity of the GFP fusion proteins. The experiment identified a subset for further investigation.

Green Fluorescent Protein-based Expression Screening of Membrane Proteins in Escherichia coli

A streamlined approach to screening for the expression of recombinant membrane proteins in Escherichia coli based on fusion to green fluorescent protein is presented.

막 단백질의 녹색 형광 단백질 기반의 표현 상영에<em&gt; 대장균</em

The production of recombinant membrane proteins for structural and functional studies remains technically challenging due to low levels of expression and ...