실험실에서 수행 된 연구 활동은 연구 재단의 보조금에 의해 지원되었다 - 플랑드르 (FWO, 부여 번호 G.0545.08 및 G.0298.11) Interuniversity 장르 폴란드 프로그램 (벨기에 과학 정책, 허가 번호 P6/28 및 P7/13) 그리고 FWO 지원 연구 커뮤니티에 포함됩니다. 플랑드르 (FWO) - CDH는 연구 재단의 박사후 사람입니다. 저자는 매우 분자 및 세포 신호 (KU 루벤), 박사 SP 스 리니 (시력 측정법의 인디애나 대학 학교, USA) 박사 Leybaert의 연구실 (겐트 대학교)의 연구소의 모든 현재 및 이전 회원들에게 감사와 있습니다 도움이 토론을 제공하는 박사 Vinken은 (VUB), 절차를 최적화하거나 넥신 hemichannels의 연구 도구의 개발에 참여했다.

1. 각막 내피 세포의 분리 시작하기 전에 : 눈 enucleating 후 현지 도축장, 가능한 한 빨리 얻은 신선한 눈에서 세포를 분리. 눈이 최대 18 개월 5 분 사후과 얼의 균형 소금 용액에 보존의 소에서 적출되었는지 확인 - 4의 1 % 요오드 용액 실험실 운송 ° C. <ol><li> 얼의 균형 소금 솔루션의 밖으로 눈을 가지고 - 1 % 요오드 용액을 페트리 접시 (100 X 20mm)에 넣습니다. </li><li> 70 % 에탄올을 포함하는 용액으로 눈을 소독하고 1 % 요오드를 포함 얼의 균형 소금 용액으로 씻어. </li><li> 에서이 단계에서, 멸균 후드에서 작동합니다. 조심스럽게 눈에서 각막을 해부하고 위로 향하게 상피 세포 층과 얼의 균형 소금 솔루션을 포함하는 페트리 접시 (35 × 10 ㎜)에 배치합니다. 주의 깊게 남아있는 홍채 조직 STI를 제거필요한 경우 각막에 부착 것이다. </li><li> 위로 내피 세포의 레이어와 페트리 접시를 포함하는 다른 얼의 균형 소금 솔루션에 각막을 전송하고 얼의 균형 소금 용액으로 두 번 헹구십시오. </li><li> 컵 모양의 접시입니다 모래에 위로 향하게 내피 층 각막을 전송하고, 성장 매체로 커버. 성장 매체는 25 mM의 포도당, 10 % 소 태아 혈청, 6.6 % L-글루타민, 2.5 ㎍ / ㎖ 암포 테리 신-B, 1 % 항생제 항진균 혼합물을 10,000 단위를 포함하는 / 페니실린의 ML, 10,000 μg을 함유 Dulbecco의 수정 이글의 중간으로 구성 스트렙토 마이신 / ㎖, 25 ㎍ / ㎖ 암포 테리 신 B. </li><li> 흡입 피펫 매체를 제거합니다. </li><li> 각막의 내피 층 (트립신을 포함하는 모든 단계가 같은 농도를 사용하여 수행 할 수 있습니다)에 트립신 용액 (0.5 g / L)의 300 μl를 적용합니다. </li><li> 적용 페트리 접시에 각막을 포함하는 모래 시계를 놓고 INC에 넣어37 30 분 동안 ubator ° C와 5 % CO 2. </li><li> 부드럽게 멸균 후드에 불 세련된 후크 모양의 유리 파스퇴르 피펫으로 각막에서 멀리 내피 세포를 긁어. </li><li> 내피 세포를 포함하는 솔루션을 빨아 문화 매체의 4 ML을 포함하는 문화 플라스크 (25cm 2)에 추가합니다. </li><li> 각막에 성장 매체 300 μl를 적용하고 긁기를 반복하고 문화 플라스크에 내피 세포가 포함 된 솔루션을 추가합니다. </li><li> 한 번 더 마지막 단계 (1.11)를 반복합니다. </li><li> 문화를 놓고 37 배양기에서 배양 배지 ° C와 5 % CO 2에서 각막 내피 세포를 포함 플라스 크입니다. </li><li> 이틀, 문화 매체의 10 ML을 추가합니다. </li><li> 격일로 성장 매체를 새로 고칩니다. </li></ol> 2. 세포 배양 <ol><li> 배지를 제거하고 도달 자랄 얼의 균형 소금 솔루션 (이란게 내에서 두 번 세포를 씻으분리 후 T는 10 일). </li><li> 를 분리하고 인큐베이터에 플라스크를 배치 할 셀에 1.5 ML 트립신 솔루션을 추가 (37 ° C, 5 % CO 2) 3-4 분. </li><li> 성장 매체 12 ML을 추가합니다. 세포를 분산하고 세포를 계산하기 위해 밖으로 중간 세 번 피펫. </li><li> 세포 밀도와 인큐베이터에 넣어 따라 변수 부분에 씨앗 세포를. 165,000 세포의 세포 수 (cm 2 당 세포 밀도 39,286) 두 잘 챔버 슬라이드 (4.2 cm 2의 면적)를 준비. cm 2 당 6,250의 밀도에 새로운 통과를 위해 80cm 2 문화 플라스크를 준비하고 25 ML의 총 볼륨에 신선한 문화 매체를 추가 할 수 있습니다. </li><li> 이틀 매체를 새로 고칩니다. </li><li> 세포 층 자랄는 3-4일에 도달 한 후에. 실험 세포를 사용합니다. </li><li> 플라스크의 세포 층의 confluency에 도달하면, 2.6 단계 2.1를 반복합니다. 통행 최대 2 세포 배양 F를 사용할 수 있습니다또는 실험. </li></ol> 3. 유도 칼슘 웨이브 기계적 자극 <ol><li> 10 μM 플루오-4와 챔버 슬라이드에 세포를로드하기에 오전 37시 30 분 생리 인산염 버퍼 ° C 가볍게 흔들어. </li><li> 플루오-4 솔루션 AM 제거, 생리 인산염 버퍼와 세포 다섯 번 씻어 염분 인산 버퍼로 세포를 배양 및 측정 전에 실온에서 적어도 5 분 동안 세포를 둡니다. </li><li> 아르곤 레이저를 사용 빔 스플리터 HFT 488와 488 nm에서 흥분은 longpass 방출 필터 LP 505를 사용하여 530 nm에서 형광 방출을 수집 최소한 핀홀을 설정합니다. 기름 침지 40X 목표 (공기, 1.2 NA)를 사용합니다. ARL-67156를 가진 실험에서 10X 목표를 사용 (공기, 0.3 NA). </li><li> 세포가 공 촛점 현미경에 합류되는 필드를 검색합니다. </li><li> 위치는 45 챔버 슬라이드에 대하여 10 °와 세포막을 터치에서되도록 피펫을.하나의 셀에 짧은 (≈ 1 초) 기계적 자극을 자극. 기계적 자극 잠깐입니다 앰프를 통해 운영 압전 크리스탈 나노 위치에 결합 된 유리 마이크로 피펫 (팁 직경 &lt;1 ㎛)로 세포막의 1 % 미만을 만져 세포의 급성, 짧은 지속 변형으로 구성 마이크로 매니퓰레이터에 장착. 유리 마이크로 피펫을 미세 전극 풀러와 함께 만들어집니다. 나노 위치가 기계적 자극하는 동안 0.2에서 1.5 V 사이의 전압으로 작동되어 있는지 확인합니다. 1.5 V보다 높은 전압 세포가 손상 될 수 있습니다. 각 세포 유형 및 조건, 세포 손상없이 기계적 자극에 대한 최적의 전압은 신중하게 높은 (1.5 V) 전압 (0.2 V)에서부터 시작 전압의 시리즈를 적용하여 결정해야합니다. 이 전압이 세포막에 적용되는 기계적 응력과 변형을 결정 때문에 전압은 자극의 힘에 대한 척도이다.기계적 자극의 힘은 지역에 기계적 스트레스를 곱하여 계산할 수 있습니다. 면적 (&lt;3.14 μm의 2) 및 기계적 스트레스가 모두 매우 낮은이기 때문에, 기계적 자극의 힘은 낮다. (세포가 손상되었을 때, 세포와 세포 밖으로 형광 누출이 어두워합니다.) </li><li> 공간적 변화를 측정 [칼슘 2 +] 공 촛점 현미경으로 기계적 자극에 따라 전. </li><li> 이미지를 수집하고 저장합니다. </li><li> 공 초점 현미경의 소프트웨어를 사용하여 반응 세포 (활성 영역, AA)의 총 면적을 정의하는 관심 다각형 영역을 그립니다. </li></ol>

저자는 공개 아무것도 없어.

이 논문에서, 우리는 마이크로 피펫을 사용하여 지역화 및 제어 기계 자극을 제공함으로써 주 소 각막 내피 세포의 단일 층에 간 칼슘 2 + 파 전파를 측정하는 간단한 방법을 설명합니다. 기계적 자극 세포는 +, 둘은 간 칼슘 2 + 파 전파 11,67 운전 필수적인 세포 내 신호 전달 분자 세포 내 IP 3 칼슘 2 지역의 증가와 함께 응답합니다. 칼슘 2 + h...

간 통신 및 신호는 조직과 전체 - 장기 레벨 1,2에서 세포 촉진제 님의 질문에 생리적 인 과정의 조정을 위해 필수적입니다. 간 의사 소통의 가장 직접적인 방법은 간격 접속점의 발생에 의해 만들어집니다. 갭 접합 3,4 인접 셀의 두 넥신 (CX는) hemichannels (그림 1)의 헤드 투 헤드 도킹에 의해 형성 단백질 성 채널입니다 간격 접합 채널의 패이다. 갭 접합 발생 및 변조 칼슘 이웃 세포 ​​6 (그림 2)의 세포 내 상점에서 + 릴리스., 칼슘 2 + 또는 IP 5 등 이하 1.5 kDa의 분자량은 작은 신호 분자의 통과를 허용 갭 접합 채널은 밀접하게 산화 환원 수정 및 같은 내 및 분자간 단백질 상호 작용에 의해 및 세포 신호 전달 과정에 의해 조절된다인산화 7. GJS 그로 인하여 화학 및 전기 syncytium 역할, 연결된 세포의 조정 반응을 촉진한다. 예를 들어, 심방 및 심실 근육 세포를 통해 심장 활동 전위의 확산은 CX-기반 GJ 채널 85에 의해 중재된다. CXS는 갭 접합 채널로서 역할을 할뿐만 아니라 짝 hemichannels을 형성하여 정기적으로 이온 채널 8-10 (그림 1)과 유사 세포막 채널로 작동하지 않습니다. Hemichannels는 내부와 세포 외 환경 사이 이온 및 신호 분자의 교환을 제어하여 이웃 세포 사이 paracrine 신호에 참여할 수 있습니다. 많은 종류의 세포 (상피 세포, 조골 세포, 성상 세포, 내피 세포 등과 같은) 및 장기 (뇌, 간, 망막, 달팽이관과 혈관 등)에 간 칼슘 2 + - 파도 다세포 반응의 조정을위한 기본적인 <suP&gt; 11. 특정 셀에 내 Ca 2 + 농도의 증가는이 셀로 제한하지만, 그로 인하여 간 칼슘 2 + 파 12,13 구축, 주변 이웃 세포에 전달되지 않습니다. 이러한 세포 간 칼슘 2 + - 파도 syncytium과 조절 장애는 병태 생리 학적 과정 11과 관련되어 같은 셀 계층의 정상적인 생리 조절을 위해 중요하다. 각막 내피 세포와 상피 세포에서, 우리 자신의 25-33 등 다른 그룹 14-24은 간 통신 메커니즘과 역할을 공부했다. 비 흥분 세포, 각막 내피 세포와 같은 세포 간 의사 소통의 두 가지 모드는 28,29, 즉 갭 접합 간 통신 및 paracrine 간 통신을 발생합니다. 갭 접합 간 통신 간격 분기점 7을 통해 신호 분자의 직접 교환을 포함한다. 갭 접합부tional 간 통신, 조직의 항상성을 유지하는 세포 증식을 조절하고, 세포 스트레스 10,34,35에 동기화 응답을 설정하기위한 중요합니다. 병리 번호, 갭 접합 커플 링으로 인해 결함이 CXS로 감소하고, 이에 갭 접합 간 통신이 36에 영향을 미치고있다. 이 다세포 생물의 격차 접합부 간 의사 소통의 중요성과 영향력을 강조한다. 그것이 확산 성 세포 메신저 (그림 2)의 방출을 포함 이후 격차 접합부 간 통신 대조적으로, paracrine 간 통신, 세포 - 세포 동격에 종속되지 않습니다. 신호 분자의 종류는 세포 신호에 의해 세포 공간에 해제됩니다. 분자 다음은 특정 수용체​​ 단백질에 의해 감지 된 대상 셀에 전송됩니다. 이후 수용체 신호 단지 어떤 세포 반응을 유도신호를 비활성화 또는 탈감작의 제거에 의해 종료됩니다. 출시 친 화성 세포 신호 메신저 멤브레인을 통과하고 세포 내 수용체에 작용합니다. 반면, 친수성 ​​메신저는 응답 세포의 세포막을 통과하지 않는다, 그러나 세포 내 환경에 신호를 중계 표면 발현 수용체 단백질에 결합하는 리간드 역할을합니다. 이온 채널 연결, 효소 결합, 및 G 단백질 - 연결 : 세포 표면 수용체 단백질의 세 가지 주요 가정은이 과정에 참여한다. 발표 메신저 분자가 가까이 (paracrine)에서 표적 세포에 동일한 셀 (autocrine)의 수용체에 작용하거나 순환 시스템 (내분비)가 필요 먼 표적 세포에. 각막 내피 세포 28,29 등 많은 종류의 세포에서, ATP는 세포 간 칼슘 2 + - 파도 37-40의 번식을 구동 주요 친수성, paracrine 요인 중 하나입니다. 지속여러 에이전트가 ING 기계적 변형, 저산소증, 염증이나 자극, ATP는 전단 응력, 스트레칭, 또는 삼투는 44,45 붓기에 대한 응답으로 41-44 건강한 세포에서 해제 할 수 있습니다. 다른 ATP 방출 메커니즘은 기공을 갖는 exocytosis를 44과 같은 ATP 결합 카세트 (ABC) 전송기, plasmalemmal 전압에 의존하는 음이온 채널 46, P2X7 수용체의 채널 47,48뿐만 아니라, 같은 전송 메커니즘의 과다 등 가정되었다 넥신의 hemichannels 49-52과 pannexin의 hemichannels 43,49,53. 세포 ATP는 ADP, AMP에 빠르게 가수 분해와 세포 외 환경에 존재하는 ectonucleotidases로 54,55를 아데노신 수 있습니다. extracellularly 발표 ATP와 그 대사 산물 ADP 56 확산을 통해 확산됩니다. 이웃 세포에서 퓨린 수용체 이러한 뉴클레오티드의 연속적인 상호 작용은 P에 연루되어있다간 칼슘 2 + - 파도 28,37,51의 ropagation. 퓨린 수용체의 두 가지 클래스가 존재한다 : 두 퓨린 (ATP, ADP)과 피리 미딘 (UTP, UDP) 뉴클레오티드 가장 P2-purinoceptors 57에 따라 행동하면서 아데노신은 P1-purinoceptors의 주요 천연 리간드이다. 간 통신 등의 부스러기 로딩, 염료 전송, IP 3 칼슘 2 +, 기계적 자극, 등과 같은 작용제 지역의 uncaging 등 다양한 방법으로 조사 할 수 있습니다. 여기에서 우리는 + 웨이브 전파는 단일 세포의 기계적 자극으로 이끌어 칼슘의 연구를 설명합니다. 기계적 자극에 의해 칼슘 2 + 파 전파 연구의 장점은 + 파 시간에 칼슘의 확산을 정량화하기 쉬운 도구를 제공하고 정량적으로 세포의 다른 전처리를 비교 할 수 있다는 것입니다. 각막 내피 세포에서 이러한 세포 간 칼슘 2 + - 파도 공동 수단층에서 조정 된 응답, 이에 안구 수술하는 동안 세포 스트레스를 견딜 수있는 내피를 돕는 비 재생 각막 내피 세포의 가능한 방어 메커니즘으로 작용 또는 면역 거부 또는 포도막염 58,59 동안 염증 매개체에 노출에.

<table border="1">
<tbody>
 <tr>
 <td>Name of Reagent/Material</td>
 <td>Company</td>
 <td>Catalog Number</td>
 <td>Column1</td>
 </tr>
 <tr>
 <td>Earle's Balanced Salt Solution (EBSS)</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>14155-048</td>
 <td></td>
 </tr>
 <tr>
 <td>Iodine</td>
 <td>Sigma-Aldrich (Deisenhofen, Germany)</td>
 <td>38060-1EA</td>
 <td></td>
 </tr>
 <tr>
 <td>Dulbecco's Modified Eagle's Medium (DMEM)</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>11960-044</td>
 <td></td>
 </tr>
 <tr>
 <td>L-glutamine (Glutamax)</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>35050-038</td>
 <td></td>
 </tr>
 <tr>
 <td>Amphotericin-B</td>
 <td>Sigma-Aldrich (Deisenhofen, Germany)</td>
 <td>A2942</td>
 <td></td>
 </tr>
 <tr>
 <td>Antibiotic-antimycotic mixture</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>15240-096</td>
 <td></td>
 </tr>
 <tr>
 <td>Trypsin</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>25300-054</td>
 <td></td>
 </tr>
 <tr>
 <td>Dulbecco's PBS</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>14190-091</td>
 <td></td>
 </tr>
 <tr>
 <td>Fluo-4 AM</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>F14217</td>
 <td></td>
 </tr>
 <tr>
 <td>ARL-67156 (6-N,N-Diethyl-b,g-dibromomethylene-D-ATP) </td>
 <td>Sigma-Aldrich (Deisenhofen, Germany)</td>
 <td>A265</td>
 <td></td>
 </tr>
 <tr>
 <td>Apyrase VI</td>
 <td>Sigma-Aldrich (Deisenhofen, Germany)</td>
 <td>A6410</td>
 <td></td>
 </tr>
 <tr>
 <td>Apyrase VII</td>
 <td>Sigma-Aldrich (Deisenhofen, Germany)</td>
 <td>A6535</td>
 <td></td>
 </tr>
 <tr>
 <td>Gap26 (VCYDKSFPISHVR)</td>
 <td>Custom peptide synthesis</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>Gap27 (SRPTEKTIFII)</td>
 <td>Custom peptide synthesis</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>Control Peptide (SRGGEKNVFIV)</td>
 <td>Custom peptide synthesis</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>siRNA1 Cx43 (sense: 5'GAAGGAGGAGGAACU-CAAAdTdT) </td>
 <td>Annealed siRNA was purchased at Eurogentec (Luik, Belgium)</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>siRNA2 Cx43 (sense: 5'CAAUUCUUCCUGCCGCAAUdTdT) </td>
 <td>Annealed siRNA was purchased at Eurogentec (Luik, Belgium)</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>siRNA scramble: scrambled sequence of siCx43-1 (sense: 5'GGUAAACG-GAACGAGAAGAdTdT) </td>
 <td>Annealed siRNA was purchased at Eurogentec (Luik, Belgium)</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>TAT-L2 (TAT- DGANVDMHLKQIEIKKFKYGIEEHGK)</td>
 <td>Thermo Electron (Ulm, Germany)</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>TAT-L2-H126K/I130N (TAT-DGANVDMKLKQNEIKKFKYGIEEHGK) </td>
 <td>Thermo Electron (Ulm, Germany)</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td></td>
 <td></td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>Two chambered glass slides</td>
 <td>Laboratory-Tek Nunc (Roskilde, Denmark)</td>
 <td>155380</td>
 <td></td>
 </tr>
 <tr>
 <td>Confocal microscope </td>
 <td>Carl Zeiss Meditec (Jena, Germany)</td>
 <td>LSM510</td>
 <td></td>
 </tr>
 <tr>
 <td>Piezoelectric crystal nanopositioner (Piezo Flexure NanoPositioner)</td>
 <td>PI Polytech (Karlsruhe, Germany)</td>
 <td>P-280</td>
 <td></td>
 </tr>
 <tr>
 <td>HVPZT-amplifier</td>
 <td>PI Polytech (Karlsruhe, Germany)</td>
 <td>E463 HVPZT-amplifier</td>
 <td></td>
 </tr>
 <tr>
 <td>Glass tubes (glass replacement 3.5 nanoliter)</td>
 <td>World Precision Instruments, Inc. Sarasota, Florida, USA</td>
 <td>4878</td>
 <td></td>
 </tr>
 <tr>
 <td>Microelectrode puller </td>
 <td>Zeitz Instrumente (Munchen, Germany)</td>
 <td>WZ DMZ-Universal Puller</td>
 <td></td>
 </tr>
</tbody>
 </table>

mechanical stimulation-induced calcium wave propagation in cell monolayers: the example of bovine corneal endothelial cells

간 통신은 뇌, 간, 망막, 달팽이관 및 혈관 등의 장기와 조직의 다양한 세포 사이의 생리적 인 과정의 조정을 위해 필수적이다. 실험 설정에서, 세포 간 칼슘 2 + - 파도 하나의 세포에 기계적 자극을 적용하여 이끌어 할 수 있습니다. 이 세포 내 신호 IP 분자 3 칼슘의 출시에 이르게 + 이웃 세포에 기계적 자극 셀에서 + 파 동심 칼슘의 번식을 시작합니다. 간 칼슘 2 + 파 전파를 제어하는 주요 분자 경로는 IP 3의 직접 전송을 통해와 ATP의 방출을 통해 hemichannels으로 갭 접합 채널에 의해 제공됩니다. 속성과 다른 넥신 갭 접합 채널 hemichannels로 pannexin 이소 규제의 식별 및 특성화 quantificatio에서 허용하는N 간 칼슘 2 + 파, siRNA를, 그리고 갭 접합 채널 hemichannels 억제제의 사용의 확산. 여기, 우리는 그 결과로 간 칼슘이 세포의 급성, 짧은 지속 변형에 의해 자극 통제 및 지역화 기계적 자극에 대한 응답으로 Fluo4 암으로로드 차 각막 내피 세포의 단일 층에있는 + 파를 측정하는 방법을 설명 이하 1 ㎛의 팁 직경 micromanipulator에 제어 유리 micropipette를 가진 세포막을 감동. 우리는 또한 주 소 각막 내피 세포와 + - 파도 ATP의 방출을 통한 세포 간 칼슘의 중심 세력으로 Cx43-hemichannel 활동을 평가하기위한 모델 시스템으로 사용의 분리를 설명합니다. 마지막으로, 우리는 사용, 장점, 한계와 갭 접합 채널 hemichannel 연구의 맥락에서이 방법의 대안을 논의한다.

모든 실험은 모든 관련 지침, 규정 및 규제 기관 준수에 실행되고 설명되는 프로토콜은 KU 루벤의 동물 관리 및 사용위원회의지도 및 승인하에 수행됩니다. 소 각막 내피 세포 (BCEC)에서 기능성 간격 접속점은 표현 격차 접합부 간 통신 및 paracrine 간 통신을 모두 상호 작용하는 방식 간 통신에 크게 기여하지만 주요 통로에 의해 중재 paracrine 간 통신 경로로 표시되었습니다 있?...

Watch this Scientific Journal Video about Mechanical Stimulation-induced Calcium Wave Propagation in Cell Monolayers: The Example of Bovine Corneal Endothelial Cells at JoVE.com

Mechanical Stimulation-induced Calcium Wave Propagation in Cell Monolayers: The Example of Bovine Corneal Endothelial Cells

간 카<sup&gt; 2 +</sup&gt; - 파도 갭 접합 채널 hemichannels에 의해 구동됩니다. 여기, 우리는 세포 간 칼슘을 측정하는 방법을 설명<sup&gt; 2 +</sup&gt; - 파 지역의 단일 셀 기계적 자극과 속성과 간격 접합 채널 hemichannels의 규정을 조사하기 위해 해당 응용 프로그램의 질문에 답변 세포 단층합니다.

세포 단일 층의 기계적 자극에 의​​한 칼슘 웨이브 전파 : 소 각막 내피 세포의 예

Intercellular communication is essential for the coordination of physiological processes between cells in a variety of organs and tissues, including the ...

mechanical-stimulation-induced-calcium-wave-propagation-cell

Research

JoVE Journal

Biology

16.1K 조회수.  KU Leuven. 간 카 2 + - 파도 갭 접합 채널 hemichannels에 의해 구동됩니다. 여기, 우리는 세포 간 칼슘을 측정하는 방법을 설명 2 + - 파 지역의 단일 셀 기계적 자극과 속성과 간격 접합 채널 hemichannels의 규정을 조사하기 위해 해당 응용 프로그램의 질문에 답변 세포 단층합니다.

비디오: Mechanical Stimulation-induced Calcium Wave Propagation in Cell Monolayers: The Example of Bovine Corneal Endothelial Cells

Propagation of Human Embryonic Stem (ES) Cells

Propagation of Human Embryonic Stem ES Cells

인간의 배아 줄기 (ES) 세포의 전파

연구

생물학

Isolation and Large Scale Expansion of Adult Human Endothelial Colony Forming Progenitor Cells

This paper introduces a novel recovery strategy for endothelial colony forming progenitor cells (ECFCs) from heparinized but otherwise unmanipulated adult human peripheral blood within a mean of 12 days. After large scale expansion &gt;1x108 ECFCs can be obtained for further tests. Advantageously by using pHPL the contact of human cells with bovine serum antigens can be excluded. By flow cytometry and immunohistochemistry the isolated cells can be characterized as ECFC and their in vitro functionality to form vascular like structures can be tested in a matrigel assay. Further these cells can be subcutaneously injected in a mouse model to form functional, perfused vessels in vivo. After long term expansion and cryopreservation proliferation, function and genomic stability appear to be preserved. 3,4
This animal-protein free isolation and expansion method is easily applicable to generate a large quantity of ECFCs.

Endothelial colony forming progenitor cells (ECFCs) are a promising tool to study vascular homeostasis and repair.1,2 This paper introduces a novel animal-serum free method for isolation and expansion of ECFC from heparinised adult human peripheral blood with pooled human platelet lysate (pHPL) diminishing the risk of anti-bovine immunisation.

분리 및 성인 인간 내피 콜로니 형성 전구 세포의 대규모 확장

This paper introduces a novel recovery strategy for endothelial colony forming progenitor cells (ECFCs) from heparinized but otherwise unmanipulated adult ...

Study of the Actin Cytoskeleton in Live Endothelial Cells Expressing GFP-Actin

The microvascular endothelium plays an important role as a selectively permeable barrier to fluids and solutes. The adhesive junctions between endothelial cells regulate permeability of the endothelium, and many studies have indicated the important contribution of the actin cytoskeleton to determining junctional integrity1-5. A cortical actin belt is thought to be important for the maintenance of stable junctions1, 2, 4, 5. In contrast, actin stress fibers are thought to generate centripetal tension within endothelial cells that weakens junctions2-5. Much of this theory has been based on studies in which endothelial cells are treated with inflammatory mediators known to increase endothelial permeability, and then fixing the cells and labeling F-actin for microscopic observation. However, these studies provide a very limited understanding of the role of the actin cytoskeleton because images of fixed cells provide only snapshots in time with no information about the dynamics of actin structures5. 
Live-cell imaging allows incorporation of the dynamic nature of the actin cytoskeleton into the studies of the mechanisms determining endothelial barrier integrity. A major advantage of this method is that the impact of various inflammatory stimuli on actin structures in endothelial cells can be assessed in the same set of living cells before and after treatment, removing potential bias that may occur when observing fixed specimens. Human umbilical vein endothelial cells (HUVEC) are transfected with a GFP-&beta;-actin plasmid and grown to confluence on glass coverslips. Time-lapse images of GFP-actin in confluent HUVEC are captured before and after the addition of inflammatory mediators that elicit time-dependent changes in endothelial barrier integrity. These studies enable visual observation of the fluid sequence of changes in the actin cytoskeleton that contribute to endothelial barrier disruption and restoration. 
Our results consistently show local, actin-rich lamellipodia formation and turnover in endothelial cells. The formation and movement of actin stress fibers can also be observed. An analysis of the frequency of formation and turnover of the local lamellipodia, before and after treatment with inflammatory stimuli can be documented by kymograph analyses. These studies provide important information on the dynamic nature of the actin cytoskeleton in endothelial cells that can used to discover previously unidentified molecular mechanisms important for the maintenance of endothelial barrier integrity.

Microscopic imaging of live endothelial cells expressing GFP-actin allows characterization of dynamic changes in cytoskeletal structures. Unlike techniques that use fixed specimens, this method provides a detailed assessment of temporal changes in the actin cytoskeleton in the same cells before, during, and after various physical, pharmacological, or inflammatory stimuli.

GFP - 굴지 표현 라이브 내피 세포 굴지의 Cytoskeleton 연구

The microvascular endothelium plays an important role as a selectively permeable barrier to fluids and solutes. The adhesive junctions between endothelial ...

Assessment of Calcium Sparks in Intact Skeletal Muscle Fibers

Maintaining homeostatic Ca2+ signaling is a fundamental physiological process in living cells. Ca2+ sparks are the elementary units of Ca2+ signaling in the striated muscle fibers that appear as highly localized Ca2+ release events mediated by ryanodine receptor (RyR) Ca2+ release channels on the sarcoplasmic reticulum (SR) membrane. Proper assessment of muscle Ca2+ sparks could provide information on the intracellular Ca2+&#160;handling properties of healthy and diseased striated muscles. Although Ca2+ sparks events are commonly seen in resting cardiomyocytes, they are rarely observed in resting skeletal muscle fibers; thus there is a need for methods to generate and analyze sparks in skeletal muscle fibers.
Detailed here is an experimental protocol for measuring Ca2+ sparks in isolated flexor digitorm brevis (FDB) muscle fibers using fluorescent Ca2+ indictors and laser scanning confocal microscopy. In this approach, isolated FDB fibers are exposed to transient hypoosmotic stress followed by a return to isotonic physiological solution. Under these conditions, a robust Ca2+ sparks response is detected adjacent to the sarcolemmal membrane in young healthy FDB muscle fibers. Altered Ca2+ sparks response is detected in dystrophic or aged skeletal muscle fibers. This approach has recently demonstrated that membrane-delimited signaling involving cross-talk between inositol (1,4,5)-triphosphate receptor (IP3R) and RyR contributes to Ca2+ spark activation in skeletal muscle. In summary, our studies using osmotic stress induced Ca2+ sparks showed that this intracellular response reflects a muscle signaling mechanism in physiology and aging/disease states, including mouse models of muscle dystrophy (mdx mice) or amyotrophic lateral sclerosis (ALS model).

Described here is a method to directly measure calcium sparks, the elementary units of Ca2+ release from sarcoplasmic reticulum&#160;in intact skeletal muscle fibers. This method utilizes osmotic-stress-mediated triggering of Ca2+ release from ryanodine receptor in isolated muscle fibers. The dynamics and homeostatic capacity of intracellular Ca2+ signaling can be employed to assess muscle function in health and disease.

칼슘의 평가는 그대로 골격 근육 섬유에서 불꽃

Maintaining homeostatic Ca2+ signaling is a fundamental physiological process in living cells. Ca2+ sparks are the elementary units of Ca2+ signaling in ...

Endothelial Cell Tube Formation Assay for the In Vitro Study of Angiogenesis

Angiogenesis is a vital process for normal tissue development and wound healing, but is also associated with a variety of pathological conditions. Using this protocol, angiogenesis may be measured in vitro in a fast, quantifiable manner. Primary or immortalized endothelial cells are mixed with conditioned media and plated on basement membrane matrix. The endothelial cells form capillary like structures in response to angiogenic signals found in conditioned media. The tube formation occurs quickly with endothelial cells beginning to align themselves within 1&#160;hr and lumen-containing tubules beginning to appear within 2 hr. Tubes can be visualized using a phase contrast inverted microscope, or the cells can be treated with calcein AM prior to the assay and tubes visualized through fluorescence or confocal microscopy. The number of branch sites/nodes, loops/meshes, or number or length of tubes formed can be easily quantified as a measure of in vitro angiogenesis. In summary, this assay can be used to identify genes and pathways that are involved in the promotion or inhibition of angiogenesis in a rapid, reproducible, and quantitative manner.

Endothelial Cell Tube Formation Assay for the In Vitro Study of Angiogenesis

The tube formation assay is a fast, quantifiable method for measuring in vitro angiogenesis. Endothelial cells are combined with conditioned media and plated on basement membrane extract. Tube formation occurs within hours and newly formed tubules easily quantified.

에 대한 내피 세포의 관 형성의 분석<em&gt; 체외</em&gt; 혈관 신생 연구

Angiogenesis is a vital process for normal tissue development and wound healing, but is also associated with a variety of pathological conditions. Using ...

Measuring the Osmotic Water Permeability Coefficient (Pf) of Spherical Cells: Isolated Plant Protoplasts as an Example

Studying AQP regulation mechanisms is crucial for the understanding of water relations at both the cellular and the whole plant levels. Presented here is a simple and very efficient method for the determination of the osmotic water permeability coefficient (Pf) in plant protoplasts, applicable in principle also to other spherical cells such as frog oocytes. The first step of the assay is the isolation of protoplasts from the plant tissue of interest by enzymatic digestion into a chamber with an appropriate isotonic solution. The second step consists of an osmotic challenge assay: protoplasts immobilized on the bottom of the chamber are submitted to a constant perfusion starting with an isotonic solution and followed by a hypotonic solution. The cell swelling is video recorded. In the third step, the images are processed offline to yield volume changes, and the time course of the volume changes is correlated with the time course of the change in osmolarity of the chamber perfusion medium, using a curve fitting procedure written in Matlab (the &#8216;PfFit&#8217;), to yield Pf.

Measuring the Osmotic Water Permeability Coefficient Pf of Spherical Cells: Isolated Plant Protoplasts as an Example

Measuring the osmotic water permeability coefficient (Pf) of cells can help understand the regulatory mechanisms of aquaporins (AQPs). Pf determination in spherical plant cell protoplasts presented here involves protoplasts isolation and numerical analysis of their initial rate of volume change as a result of an osmotic challenge during constant bath perfusion.

삼투 물 투수 계수 (P 측정<sub&gt; F</sub&gt;) 구형 세포 : 예를 들어 식물 절연 원형질체

Studying AQP regulation mechanisms is crucial for the understanding of water relations at both the cellular and the whole plant levels. Presented here is ...

Isolation of Murine Valve Endothelial Cells

Normal valve structures consist of stratified layers of specialized extracellular matrix (ECM) interspersed with valve interstitial cells (VICs) and surrounded by a monolayer of valve endothelial cells (VECs). VECs play essential roles in establishing the valve structures during embryonic development, and are important for maintaining life-long valve integrity and function. In contrast to a continuous endothelium over the surface of healthy valve leaflets, VEC disruption is commonly observed in malfunctioning valves and is associated with pathological processes that promote valve disease and dysfunction. Despite the clinical relevance, focused studies determining the contribution of VECs to development and disease processes are limited. The isolation of VECs from animal models would allow for cell-specific experimentation. VECs have been isolated from large animal adult models but due to their small population size, fragileness, and lack of specific markers, no reports of VEC isolations in embryos or adult small animal models have been reported. Here we describe a novel method that allows for the direct isolation of VECs from mice at embryonic and adult stages. Utilizing the Tie2-GFP reporter model that labels all endothelial cells with Green Fluorescent Protein (GFP), we have been successful in isolating GFP-positive (and negative) cells from the semilunar and atrioventricular valve regions using fluorescence activated cell sorting (FACS). Isolated GFP-positive VECs are enriched for endothelial markers, including CD31 and von Willebrand Factor (vWF), and retain endothelial cell expression when cultured; while, GFP-negative cells exhibit molecular profiles and cell shapes consistent with VIC phenotypes. The ability to isolate embryonic and adult murine VECs allows for previously unattainable molecular and functional studies to be carried out on a specific valve cell population, which will greatly improve our understanding of valve development and disease mechanisms.

The ability to isolate heart valve endothelial cells (VECs) is critical for understanding mechanisms of valve development, maintenance, and disease. Here we describe the isolation of VECs from embryonic and adult Tie2-GFP mice using FACS that will allow for studies determining the contribution of VECs in developmental and disease processes.

쥐과 밸브 내피 세포의 분리

Normal valve structures consist of stratified layers of specialized extracellular matrix (ECM) interspersed with valve interstitial cells (VICs) and ...

Quantitation of Endothelial Cell Adhesiveness In Vitro

One of the cardinal processes of inflammation is the infiltration of immune cells from the lumen of the blood vessel to the surrounding tissue. This occurs when endothelial cells, which line blood vessels, become adhesive to circulating immune cells such as monocytes. In vitro measurement of this adhesiveness has until now been done by quantifying the total number of monocytes that adhere to an endothelial layer either as a direct count or by indirect measurement of the fluorescence of adherent monocytes. While such measurements do indicate the average adhesiveness of the endothelial cell population, they are confounded by a number of factors, such as cell number, and do not reveal the proportion of endothelial cells that are actually adhesive. Here we describe and demonstrate a method which allows the enumeration of adhesive cells within a tested population of endothelial monolayer. Endothelial cells are grown on glass coverslips and following desired treatment are challenged with monocytes (that may be fluorescently labeled). After incubation, a rinsing procedure, involving multiple rounds of immersion and draining, the cells are fixed. Adhesive endothelial cells, which are surrounded by monocytes are readily identified and enumerated, giving an adhesion index that reveals the actual proportion of endothelial cells within the population that are adhesive.

Quantitation of Endothelial Cell Adhesiveness In Vitro

We report an in vitro method that allows the quantitation of the actual number of adhesive cells within an endothelial cell monolayer.

내피 세포 접착 정량<em&gt; 체외</em

One of the cardinal processes of inflammation is the infiltration of immune cells from the lumen of the blood vessel to the surrounding tissue. This ...

High-resolution Time-lapse Imaging and Automated Analysis of Microtubule Dynamics in Living Human Umbilical Vein Endothelial Cells

The physiological process by which new vasculature forms from existing vasculature requires specific signaling events that trigger morphological changes within individual endothelial cells (ECs). These processes are critical for homeostatic maintenance such as wound healing, and are also crucial in promoting tumor growth and metastasis. EC morphology is defined by the organization of the cytoskeleton, a tightly regulated system of actin and microtubule (MT) dynamics that is known to control EC branching, polarity and directional migration, essential components of angiogenesis. To study MT dynamics, we used high-resolution fluorescence microscopy coupled with computational image analysis of fluorescently-labeled MT plus-ends to investigate MT growth dynamics and the regulation of EC branching morphology and directional migration. Time-lapse imaging of living Human Umbilical Vein Endothelial Cells (HUVECs) was performed following transfection with fluorescently-labeled MT End Binding protein 3 (EB3) and Mitotic Centromere Associated Kinesin (MCAK)-specific cDNA constructs to evaluate effects on MT dynamics. PlusTipTracker software was used to track EB3-labeled MT plus ends in order to measure MT growth speeds and MT growth lifetimes in time-lapse images. This methodology allows for the study of MT dynamics and the identification of how localized regulation of MT dynamics within sub-cellular regions contributes to the angiogenic processes of EC branching and migration.

Protocols for Human Umbilical Vein Endothelial Cell (HUVEC) culture, transient transfection of fluorescently-labeled markers of microtubule growth, live-cell imaging and automated analysis of interphase microtubule growth dynamics are detailed.

고해상도 시간 경과 이미징 및 생활 인간 제대 정맥 내피 세포의 미세 소관 역학의 자동 분석

The physiological process by which new vasculature forms from existing vasculature requires specific signaling events that trigger morphological changes ...

A Graphical User Interface for Software-assisted Tracking of Protein Concentration in Dynamic Cellular Protrusions

Filopodia are dynamic, finger-like cellular protrusions associated with migration and cell-cell communication. In order to better understand the complex signaling mechanisms underlying filopodial initiation, elongation and subsequent stabilization or retraction, it is crucial to determine the spatio-temporal protein activity in these dynamic structures. To analyze protein function in filopodia, we recently developed a semi-automated tracking algorithm that adapts to filopodial shape-changes, thus allowing parallel analysis of protrusion dynamics and relative protein concentration along the whole filopodial length. Here, we present a detailed step-by-step protocol for optimized cell handling, image acquisition and software analysis. We further provide instructions for the use of optional features during image analysis and data representation, as well as troubleshooting guidelines for all critical steps along the way. Finally, we also include a comparison of the described image analysis software with other programs available for filopodia quantification. Together, the presented protocol provides a framework for accurate analysis of protein dynamics in filopodial protrusions using image analysis software.

We present a software solution for semi-automated tracking of relative protein concentration along the length of dynamic cellular protrusions.

동적 세포 돌출부에서 소프트웨어를 이용한 단백질 농도 추적을위한 그래픽 사용자 인터페이스

Filopodia are dynamic, finger-like cellular protrusions associated with migration and cell-cell communication. In order to better understand the complex ...

세포 단일 층의 기계적 자극에 의​​한 칼슘 웨이브 전파 : 소 각막 내피 세포의 예

세포 단일 층의 기계적 자극에 의한 칼슘 웨이브 전파 : 소 각막 내피 세포의 예