이 작품은 DK52057 및 K.V.K. X.P에 NIH에서 DK107498는 NIH에서 제도적 교육 부여 2T32DK007201에 의해 지원 되었다 연구 보조금에 의해 지원 되었다.

1. 펩 티 드의 처리
<ol><li>디자인 및 펩 티 드 순서<ol>
<li>펩 티 드, 원하는 시퀀스 선택한 myc 피토 프 (EQKLISEED)에서 그 중 N-또는 C-말단 같은 태그를 추가 합니다.</li>
		<li>펩 티 드 가용성 계산기 http://pepcalc.com/peptide-solubility-calculator.php를 사용 하 여 물에 펩 티 드의 예측된 가용성을 확인 합니다. 용 해도 낮은 경우 충전 균형을 변경 하려면 다른 수용 성 태그를 추가 하십시오. 참고: 우리는 N 종점 (Myc-fll-GLUT4)에 펩 티 드에 해당 하는 첫 번째 luminal 루프 (fll) GLUT4 myc epitope (굵은 글꼴)와 태그의 사용: EQKLISEEDLNAPQKVIEQSYNATWLGRQGPGGPSSIPPGTLTTLWA 물에 있는 "좋은" 예측된 가용성을 .</li>
		<li>75% 이상으로 주문 펩 티 드 순서 순도 분석 결과 대 한 충분 한 이며 가용성 테스트에 대 한 공급자를 요청. 펩 티 드를 녹이는 뜻하지 않은 문제가 있을 때 두 개 이상의 aliquots에 순서를 구분 합니다. 참고: Myc fll GLUT4 두 aliquots에 명령 했다. 초순에 보고 된 그것의 가용성은 ≤ 10 mg/mL 이다.</li>
	</ol>
</li>
	<li>펩 티 드를 녹이는 참고: 초순 최고의 용 매는. 펩 티 드 수용 성 수 나타나지 않을 경우 자세한 내용은 http://www.genscript.com/peptide_solubility_and_stablity.html를 참조 하십시오.<ol>
<li>초순에 또는 버퍼의 선택, 100 μ g/mL의 농도에서 펩 티 드의 작업 솔루션 x 100을 준비 합니다.</li>
		<li>50-100 µ L aliquots로 솔루션을 분리 하 고-20 ° c.에서 그들을 저장합니다</li>
	</ol>
</li>
</ol>2입니다. 셀의 처리
<ol><li>세포 배양<ol>
<li>야생 타입 (WT) 세포를 사용 하 여 부정적인 제어 및 태그 6 히스티딘 (HisP)와 대상 단백질을 표현 하는 세포로. 참고: 우리는 3T3 L1 사전 adipocytes 안정적으로 Sortilin-myc를 / 그의5페를 사용 합니다.</li>
		<li>Dulbecco의 수정이 글 중간 (DMEM) 높은 설탕, 보충 10% 송아지 소 혈 청, 세포 성장 글루타민 (2mm)과 페니실린/스 (5 μ g/mL) 10% CO2에서 37 ° C에서.</li>
		<li>셀의 4 개의 10cm 요리, HisP와 그들의 두 transfect 앉아서 transfect 제어 플라스 미드 (WT)와 다른 두. transfection 후 48 h, 셀 80-90 %confluency 도달 한다.</li>
	</ol>
</li>
	<li>세포 Lysates의 준비<ol>
<li>세포의 용 해 버퍼 (10 mM Hepes, 30 mM NaCl, 5% 글리세롤, 10mm 이미, 0.5% 트라이 톤 X-100 및 프로 테아 제 억제제 태그 그의 단백질, pH 7.4의 격리에 대 한 EDTA 없이 칵테일)를 준비 하 고 4 계속 ° c:</li>
		<li>세 번 인산 염 버퍼 식 염 수 (PBS) 4 ° c.에서 x 1의 10 mL와 함께 세포를 씻어</li>
		<li>얼음에 접시를 넣고 각 접시 500 µ L의 세포의 용 해 버퍼를 추가. 셀 스 크레이 퍼를 사용 하 여 세포 lysates 수확.</li>
		<li>장소 세포 lysate 각 접시에서 다른 1.5 mL 튜브에. WT-pH6, WT pH8, HisP pH6, HisP pH8 튜브 라벨.</li>
		<li>통과 세포 lysates 주사기 26 G 바늘 5 배 아래로, 완전 한 세포를.</li>
		<li>4 ° c.에서 10 분 동안 16000 x g에서 세포 lysates 원심</li>
		<li>새로운 동일 하 게 레이블이 지정 된 튜브는 supernatants 전송.</li>
		<li>BCA 단백질 분석 실험 키트 또는 다른 키트를 사용 하 여 단백질 농도 분석 합니다.</li>
		<li>세포의 용 해 버퍼 사용 하 여, 모든 4 개의 lysates의 단백질 농도 맞춰야.</li>
		<li>각 lysate의 작은 (ca. 20 µ L) 약 수 고 가능한 제어 실험 및 문제 해결-20 ° C에서 그것을 유지 합니다.</li>
	</ol>
</li>
</ol>3. HisPur 코발트 구슬에 그의 태그 단백질 바인딩
<ol><li>상업적으로 이용 가능한 워시 버퍼를 사용 하 여 또는 하나 (50 m m 나2HPO4/NaH2포4, 300 mM NaCl, 20 mM 이미, pH 8)을 준비 하 고 4 ° c.에 그것을 유지합니다</li>
	<li>씻어 준비 버퍼 ph 6 tittering 워시 버퍼 pH 8에 의해 HCl.와 그것은 4 ° c.에</li>
	<li>부드럽게 동종 정지 있도록 코발트 구슬의 병을 소용돌이 친다.</li>
	<li>4 개의 1.5 mL 튜브 위에서 표시 (단계 2.2.4) 코발트 구슬 서 스 펜 션의 40 µ L을 분배.</li>
	<li>각 튜브에 세포의 용 해 버퍼의 1 mL을 추가 하 고 5 s. Aspirate는 상쾌한에 대 한 1000 x g에서 튜브를 원심 침전된 구슬에 40 μ의 세포의 용 해 버퍼를 추가.</li>
	<li>해당 튜브에 세포 lysates를 추가 합니다.</li>
	<li>튜브 회전 20 rpm에 4 ° C에서 90 분 동안 튜브를 품 어.</li>
	<li>1000에 튜브를 원심 5 s를 수집은 상쾌한 g x. 4 ° c.에는 상쾌한을 유지</li>
	<li>해당 관에 pH 8 또는 pH 6 워시 버퍼의 500 µ L을 추가 하 고 다시 부드럽게 구슬 일시 중단.</li>
	<li>1000 x g 5 s 및 폐기에 튜브 원심은 supernatants.</li>
	<li>4 시간 동안 3.9-3.10 단계를 반복 합니다.</li>
</ol>4. 구슬에 움직일 그의 태그 단백질을 펩 티 드의 바인딩
<ol><li>펩 티 드 (1.2.1 단계)의 100 배 작업 솔루션을 사용 하 여 준비 작업 솔루션 pH 6 또는 pH 8 워시 버퍼 (각 2 개의 100 µ L aliquots, 1 µ g/mL) x 1.</li>
	<li>해당 ph 씻어 구슬에 1 x 펩 티 드 솔루션의 100 μ를 추가 합니다.</li>
	<li>20 rpm에서 튜브 회전에 4 ° C에서 30 분 동안 구슬을 품 어.</li>
	<li>1000 x g 5에서 튜브 원심 s는 상쾌한 수집 및-20 ° c.에 그것을 유지</li>
	<li>4 시간 동안 3.9-3.10 단계를 반복 합니다. 참고: 가능한 배경 감소, 다음 단계는 4.4 ~ 4.5 단계 대체할 수 있다.</li>
	<li>4 마이크로 열 30 μ m 모 공, 단계 2.2.4에서 그들을 라벨 고 열 수집 튜브에 배치.</li>
	<li>후 단계 4.3의 완료 열에 인큐베이션 혼합물을 전송, 중력에 의해 통과 솔루션을 수 있습니다. -20 ° c.에를 통해 흐름을 유지</li>
	<li>중력에 의해 워시 버퍼 pH 6 또는 해당 열 통해 pH 8의 500 µ L를 전달 합니다. 삭제를 통해 흐름.</li>
	<li>반복 단계 4.8 4 시간.</li>
	<li>마지막 세척 후 원심 1000 x g 15에서 열 s.</li>
</ol>5입니다. 코발트 구슬에서 차입
<ol><li>사용 상업 Tricine 샘플 버퍼 (200 mM Tris HCl, 40% 글리세롤, 2 %SDS, 0.04 %Coomassie 파란, pH 6.8) 2%의 최종 농도에 β-mercaptoethanol을 추가.</li>
	<li>씻어 구슬과 소용돌이 샘플을 Tricine 샘플 버퍼 (β-mercaptoethanol)의 40 µ L를 추가 합니다.</li>
	<li>100 ° C에서 10 분에 대 한 샘플 열 소용돌이 다시, 샘플 1000 x g 5에서 튜브 원심 및 s. 참고: 감소는 차입에서 가능한 일반적인 바인딩, 다음 단계는 단계 5.1-5.3 대체할 수 있다.</li>
	<li>추가할 차입 이미 버퍼 (50 m m 나2HPO4/NaH2포4, 300 m NaCl, 이미 0.25 M m)의 40 μ는 씻어 비즈, 소용돌이 및 20 분 동안 실내 온도에 튜브를 품 어.</li>
	<li>3000 x g 30에 튜브 원심 s, 상쾌한 (eluted 샘플)를 수집 하 고 새로운 분류 관에 그것을 전송.</li>
	<li>각 튜브를 Tricine 샘플 버퍼의 40 μ를 추가, 100 ° C, 소용돌이 원심 분리기에서 10 분에 대 한 샘플 열 5 1000 x g에서 튜브 s. 참고: 마이크로 열 사용 되는 경우, 세척된 구슬, 차입 버퍼 추가 20 분 동안 품 어 고 2 분 동안 8000 x g에서 원심 분리 하 여는 차입을 수집 합니다. 참고: 샘플까지 전기 이동 법 수행-20 ° C에서 보관할 수 있습니다.</li>
</ol>6. 전기 및 서 부 럽
참고: 샘플은 SDS 페이지와 후속 부 럽 분리에 대 한 준비. 젤 전기 이동 법 (https://www.jove.com/science-education/5065/the-western-blot) 다음 수정 프로토콜을 따릅니다.
<ol><li>상업적으로 사용할 수 있는 10-20 %Tricine 그라데이션 젤을 사용 합니다.</li>
	<li>젤에 eluted 샘플 20 µ L lysates (단계 2.2.10)의 20 µ L을 로드 합니다. 문제 해결에 대 한 것이 좋습니다 언바운드 재료 (3.8 단계)의 20 µ L을 로드 하 고 10; 펩 티 드의 ng 로드 하기 전에 이러한 샘플을 Tricine 샘플 버퍼의 동일한 금액을 추가 합니다.</li>
	<li>전기 이동 법 상용 트리 스/Tricine/SDS 실행 버퍼 (100 mM Tris, 100 mM Tricine, 및 0.1 %SDS, pH 8.3)에서 실시 합니다.</li>
	<li>전송 버퍼 (25mm Tris 기지, 192 m m 글리신, pH 8.4) 20% 메탄올을 가진 보충을 사용 하 여 0.45 μ m 니트로 막에 젤에서 자료를 전송 합니다.</li>
	<li>3%를 막 차단 소 혈 청 알 부 민 (BSA) 실 온에서 1 h. 가이드로 미리 스테인드 분자량 마커를 사용 하 여, 막 가로로 잘라, HisP에 대 한 항 체와 상단 부분 얼룩과 myc 태그 펩 티 드를 식별 하기 위해 myc epitope에 대 한 항 체와 함께 하단 부분 얼룩 있습니다. 참고: 특정 경우에 막의 절단 필요 하지 않습니다 이후 HisP, Myc fll GLUT4 안티 myc 항 체를 검출 될 수 있다.</li>
</ol>7입니다. 결과의 분석
<ol><li>이미지 역 또는 ImageJ 프로그램을 사용 하 여 모든 서쪽 오 점 신호 강도 수량화 합니다.</li>
	<li>Myc 태그 모두 pH 값에서 HisP에서 신호에 대 한 펩 티 드에서 신호를 정상화.</li>
</ol>

<ol><li>Bogan, J. S. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((Regulation+of+glucose+transporter+translocation+in+health+and+diabetes%5BTitle%5D)+AND+%22Annu+Rev+Biochem%22%5BJournal%5D)">Regulation of glucose transporter translocation in health and diabetes.</a> Annu Rev Biochem. 81, 507-532 (2012).</li>
<li>Kandror, K. V., Pilch, P. F. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((The+sugar+is+sIRVed%3A+sorting+Glut4+and+its+fellow+travelers%5BTitle%5D)+AND+%22Traffic%22%5BJournal%5D)">The sugar is sIRVed: sorting Glut4 and its fellow travelers.</a> Traffic. 12 (6), 665-671 (2011).</li>
<li>Pan, X., Zaarur, N., Singh, M., Morin, P., Kandror, K. V. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((Sortilin+and+retromer+mediate+retrograde+transport+of+Glut4+in+3T3-L1+adipocytes%5BTitle%5D)+AND+%22Mol+Biol+Cell%22%5BJournal%5D)">Sortilin and retromer mediate retrograde transport of Glut4 in 3T3-L1 adipocytes.</a> Mol Biol Cell. 28 (12), 1667-1675 (2017).</li>
<li>Kim, J., Kandror, K. V. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((The+first+luminal+loop+confers+insulin+responsiveness+to+the+glucose+transporter+4%5BTitle%5D)+AND+%22Mol+Biol+Cell%22%5BJournal%5D)">The first luminal loop confers insulin responsiveness to the glucose transporter 4.</a> Mol Biol Cell. 23 (5), 910-917 (2012).</li>
<li>Shi, J., Kandror, K. V. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((Sortilin+is+essential+and+sufficient+for+the+formation+of+Glut4-storage+vesicles+in+3T3-L1+adipocytes%5BTitle%5D)+AND+%22Dev+Cell%22%5BJournal%5D)">Sortilin is essential and sufficient for the formation of Glut4-storage vesicles in 3T3-L1 adipocytes.</a> Dev Cell. 9 (1), 99-108 (2005).</li>
<li>Coutinho, M. F., Prata, M. J., Alves, S. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((A+shortcut+to+the+lysosome%3A+the+mannose-6-phosphate-independent+pathway%5BTitle%5D)+AND+%22Mol+Genet+Metab%22%5BJournal%5D)">A shortcut to the lysosome: the mannose-6-phosphate-independent pathway.</a> Mol Genet Metab. 107 (3), 257-266 (2012).</li>
<li>Willnow, T. E., Petersen, C. M., Nykjaer, A. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((VPS10P-domain+receptors+-+regulators+of+neuronal+viability+and+function%5BTitle%5D)+AND+%22Nat+Rev+Neurosci%22%5BJournal%5D)">VPS10P-domain receptors - regulators of neuronal viability and function.</a> Nat Rev Neurosci. 9 (12), 899-909 (2008).</li>
<li>Mazella, J., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((The+100-kDa+neurotensin+receptor+is+gp95%2Fsortilin%2C+a+non-G-protein-coupled+receptor%5BTitle%5D)+AND+%22J+Biol+Chem%22%5BJournal%5D)">The 100-kDa neurotensin receptor is gp95/sortilin, a non-G-protein-coupled receptor.</a> J Biol Chem. 273 (41), 26273-26276 (1998).</li>
<li>Ni, X., Morales, C. R. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((The+Lysosomal+Trafficking+of+Acid+Sphingomyelinase+is+Mediated+by+Sortilin+and+Mannose+6-phosphate+Receptor%5BTitle%5D)+AND+%22Traffic%22%5BJournal%5D)">The Lysosomal Trafficking of Acid Sphingomyelinase is Mediated by Sortilin and Mannose 6-phosphate Receptor.</a> Traffic. 7 (7), 889-902 (2006).</li>
<li>Westergaard, U. B., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((Functional+organization+of+the+sortilin+Vps10p+domain%5BTitle%5D)+AND+%22J+Biol+Chem%22%5BJournal%5D)">Functional organization of the sortilin Vps10p domain.</a> J Biol Chem. 279 (48), 50221-50229 (2004).</li>
<li>Nykjaer, A., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((Sortilin+is+essential+for+proNGF-induced+neuronal+cell+death%5BTitle%5D)+AND+%22Nature%22%5BJournal%5D)">Sortilin is essential for proNGF-induced neuronal cell death.</a> Nature. 427 (6977), 843-848 (2004).</li>
</ol>

저자는 공개 없다.

Sortilin는 진화 보존된 멀티 ligand 단백질 수용 체 세포내 정렬 이벤트6,7와 원형질 막에 두 신호에 관련 된 이다. 그러나, 정통 sortilin의 ligands (일부는 luminal 또는 완전 한 막 단백질)에 대 한 검색은 복잡 하다 바인딩 파트너의 일부와 함께 sortilin의 상호 작용 세제에 민감한 것 같다. 따라서, 쉽게 그리고 단백질 단백질 상호 작용, 공부에 대 한 광범위 한 ?...

GLUT4 지방과 골격 근육 세포 그것 후 높은가격순 혈액 포도 당 정리1에 인슐린의 효과 중재 하는 곳에 주로 표현 되는 포도 당 운송업 자 단백질 이다. 매우 안정적인 단백질 이기 때문에, GLUT4 닢 수준에 통제 된다. 인슐린의 부재에 GLUT4 크게 원형질 막 (포도 당에 대 한 따라서 낮은 기저 침투성)에서 제외 되 고 주로 셀 내부를 작은 인슐린 응답 소포 (IRVs)에서 지역화 및 trans Golgi 네트워크 (TGN) 나타낼 수 있는 어브 기증자 구획입니다. 인슐린 관리 시는 IRVs 원형질 막으로 융합 하 고 그 작동의 사이트에 GLUT4를 제공 합니다. 그래서 adipocytes 및 골격 myocytes 혈액에서 포도 당 통풍 관 그 상승 10 ~ 40이 혈당, 원형질 막의 침투성을 증가 합니다. 인슐린 철수 후 GLUT4 초기/정렬 endosomes에 내 고 검색 TGN는 IRVs는 다시 형성 하. 두 정렬 단계 GLUT4 통로, 즉 주변 초기 endosomes에서 perinuclear TGN을 검색에는 IRVs의 대형 막 Vps10p 가족, 형식을 나타내는 sortilin에 의해 활성화 되어 TGN 기증자에 나 막 횡단 단백질 그리고 정렬 수용 체입니다. Sortilin 비 계 막 횡단 단백질으로 작동 하는 하나의 모델에 따르면: 그것은 GLUT4 endosomes의 TGN, 루멘에 바인딩하고 신병은 기증자 막 통해 의 세포질 측에 retromer 또는 clathrin 어댑터의 C-터미널2, 3. 세포내 구획 사이 GLUT4 이동 기공을 사업자에 GLUT4의 배포를 용이 하 게이.
Retromer와 다양 한 접합 기 단백질 sortilin의 세포질 꼬리의 상호 작용을 잘 문서화 되었습니다. 그러나, sortilin GLUT4 (와 몇몇의 다른 단백질 ligands)의 바인딩 증명 하기 위해 도전 하고있다. 특히, 공동 immunoprecipitate sortilin 및 GLUT4 하려고가 두 단백질 사이 상호 작용의 세제에 민감한 특성상 아마 성공 되지 않았습니다. 또한 일반 운송업 자 단백질 GLUT4 12 막 횡단 도메인 및 6 luminal 루프는 조합 잠재적으로 sortilin 바인딩 사이트를 나타낼 수 있다. 동시에 효 모 2 잡종 시스템에 막 침투성 DSP와 상호 작용 cross-linking 셀에 실질적인 공동 지역화 등 간접 증거의 큰 몸 그 sortilin GLUT4 바인딩할 수 있는 것이 좋습니다. 또한, mutagenesis 스캔 알라닌과 조합에서 후자의 방식을 사용 하 여 우리는 이전 결정 sortilin의 Vps10p 도메인 주로 GLUT4의 첫 번째 luminal 루프에 바인딩합니다. 그러나, 포유류 세포에 이러한 상호 작용의 증거는 실종 되었습니다. 여기, 우리 산 성 환경에서 유사한 transfected 3T3-L1 셀 코발트 수 지를 사용 하 여 pH 6 및 pH 8에 GLUT4의 첫 번째 luminal 루프에 해당 하는 화학적으로 합성된 펩 티 드와 상호 작용할 수 있는 증명에서 그의 태그 sortilin 격리는 endosomal 루멘 그리고 TGN 막의 루멘에서 중립 환경. 아니 펩 티 드 바인딩 비 transfected 세포에서 준비 된 추출 물 같은 구슬에 로드 된 컨트롤 실험에서 발견 되었다.

<table><tbody><tr><td>Protease inhibitor cocktail</td><td>Sigma</td><td>P8849</td><td>for use in purification of histidine tag protein</td></tr><tr><td>Phosphate-Buffered Saline&amp;nbsp;</td><td>Corning</td><td>21-040-CV</td><td>PBS</td></tr><tr><td>1mL Insulin Syringe U-100</td><td>BD</td><td>329652</td><td>26G x 1/2</td></tr><tr><td>BCA Protein Assay Kit</td><td>Pierce</td><td>23228</td><td></td></tr><tr><td>Wash buffer</td><td>Boston BioProducts</td><td>BP-234</td><td>For His-tag protein purification</td></tr><tr><td>HisPur Cobalt Resin</td><td>Thermo Scientific</td><td>89964</td><td></td></tr><tr><td>Tricine sample Buffer</td><td>Bio-Rad</td><td>161-0739</td><td>with SDS, bMercaptaethanol should be added</td></tr><tr><td>Elution&amp;nbsp; Buffer</td><td>Boston BioProducts</td><td>BP-236</td><td>For His-tag protein purificationwith 250mM Imidazole</td></tr><tr><td>Mini-Protean Tris-Tricine precast gels 10-20%&amp;nbsp;</td><td>Bio-Rad</td><td>456-3115</td><td>For seperation of peptide and small protein</td></tr><tr><td>Tris/Tricine/SDS running buffer&amp;nbsp;</td><td>Bio-Rad</td><td>161-0744</td><td></td></tr><tr><td>Transfer Buffer</td><td>Boston BioProducts</td><td>BP-190</td><td>Add 20% methanol</td></tr><tr><td>Nitrocellulose membrane&amp;nbsp; 0.45 mm</td><td>Bio-Rad</td><td>1620115</td><td></td></tr><tr><td>Bovine Serum Albumin</td><td>Sigma</td><td>A9647</td><td>BSA</td></tr><tr><td>Anti Myc antibody</td><td>Cell Signaling</td><td>2272</td><td>Rabbit</td></tr><tr><td>Peptide</td><td>Genscipt</td><td></td><td>customize ordering</td></tr><tr><td>Precision Plus Protein Dual color Standarts</td><td>BioRad</td><td>161-0374</td><td></td></tr></tbody></table>

detection of detergent-sensitive interactions between membrane proteins

단백질 단백질 상호 작용을 탐구 하는 능력은 셀에 규제 연결을 이해 하는 열쇠. 그러나, 많은 경우에 단백질-단백질 상호 작용의 중요 한 실험 과제와 연결 됩니다. 특히, 정렬 수용 체 그들의 단백질 화물이이 단백질의 공동-immunoprecipitation을 사용할 수 없게 만드는 세제에 민감한 패션에서 자주 막 구획의 루멘에서 상호 작용 합니다. 포도 당 운송업 자 GLUT4 약한 luminal 상호 막 단백질의 한 예로 봉사 수로 정렬 수용 체 sortilin의 바인딩. 여기, 우리는 sortilin 및 GLUT4 사이의 상호 작용을 확인 하기 위해, 간단한, 빠르고 저렴 한 분석 결과 설명 합니다. 우리는 설계 및 GLUT4 luminal 부분에 잠재적인 sortilin 바인딩 epitope를 해당 myc 태그 펩타이드를 화학적으로 합성. Sortilin 6 히스티딘 태그로 포유류 세포에 표현 되었고 세포 lysates 코발트 비즈를 사용 하 여에서 격리. Sortilin 구슬에 움직일 수 다른 pH 값, 펩 티 드 솔루션으로 알을 품는 그리고 서쪽 blotting에 의해 eluted 자료 분석. 이 분석 결과 다른 세제에 민감한 단백질-단백질 상호 작용 연구를 쉽게 적용할 수 있습니다.

Lysates L1 셀 Sortilin-myc를 / 그의5 와 WT 3T3 L1 셀, 부정적인 컨트롤 사용에서 안정적으로 페 3T3에서 준비 되었다. 두 lysates pH 6 또는 pH 8에 코발트 구슬과 incubated 되었고 철저 하 게 씻어. 고정 단백질 구슬 Myc fll Glut4 솔루션에서 incubated 다음 했다. 주의 세척 후 단백질 구슬에 바인딩된 했다 eluted 0.25 M 이미와 함께. SDS-페이지 10-20% Tricine sortilin-myc를 / 그의 둘 다...

Watch this Scientific Journal Video about Detection of Detergent-sensitive Interactions Between Membrane Proteins at JoVE.com

Detection of Detergent-sensitive Interactions Between Membrane Proteins

우리는 세제에 민감한 예를 들어 정렬 수용 체, sortilin, GLUT4, 포도 당 운송업 자 단백질의 첫 번째 luminal 루프의 바인딩을 사용 하는 막 단백질 사이 상호 작용의 탐지에 대 한 프로토콜을 설명 합니다.

세제에 민감한 막 단백질 사이 상호 작용의 탐지

Our ability to explore protein-protein interactions is the key to understanding regulatory connections in the cell. However, detection of protein-protein ...

detection-detergent-sensitive-interactions-between-membrane

Research

JoVE Journal

Biochemistry

5.9K 조회수.  Boston University School of Medicine. 우리는 세제에 민감한 예를 들어 정렬 수용 체, sortilin, GLUT4, 포도 당 운송업 자 단백질의 첫 번째 luminal 루프의 바인딩을 사용 하는 막 단백질 사이 상호 작용의 탐지에 대 한 프로토콜을 설명 합니다.

비디오: Detection of Detergent-sensitive Interactions Between Membrane Proteins

Method to Visualize and Analyze Membrane Interacting Proteins by Transmission Electron Microscopy

Monotopic proteins exert their function when attached to a membrane surface, and such interactions depend on the specific lipid composition and on the availability of enough area to perform the function. Nanodiscs are used to provide a membrane surface of controlled size and lipid content. In the absence of bound extrinsic proteins, sodium phosphotungstate-stained nanodiscs appear as stacks of coins when viewed from the side by transmission electron microscopy (TEM). This protocol is therefore designed to intentionally promote stacking; consequently, the prevention of stacking can be interpreted as the binding of the membrane-binding protein to the nanodisc. In a further step, the TEM images of the protein-nanodisc complexes can be processed with standard single-particle methods to yield low-resolution structures as a basis for higher resolution cryoEM work. Furthermore, the nanodiscs provide samples suitable for either TEM or non-denaturing gel electrophoresis. To illustrate the method, Ca2+-induced binding of 5-lipoxygenase on nanodiscs is presented.

Many proteins perform their function when attached to membrane surfaces. The binding of extrinsic proteins on nanodisc membranes can be indirectly imaged by transmission electron microscopy. We show that the characteristic stacking (rouleau) of nanodiscs induced by the negative stain sodium phosphotungstate is prevented by the binding of extrinsic protein.

방법은 시각화 및 투과 전자 현미경에 의해 막 상호 작용하는 단백질을 분석하는

Monotopic proteins exert their function when attached to a membrane surface, and such interactions depend on the specific lipid composition and on the ...

연구

생화학

Contrast-Matching Detergent in Small-Angle Neutron Scattering Experiments for Membrane Protein Structural Analysis and Ab Initio Modeling

The biological small-angle neutron scattering instrument at the High-Flux Isotope Reactor of Oak Ridge National Laboratory is dedicated to the investigation of biological materials, biofuel processing, and bio-inspired materials covering nanometer to micrometer length scales. The methods presented here for investigating physical properties (i.e., size and shape) of membrane proteins (here, MmIAP, an intramembrane aspartyl protease from Methanoculleus marisnigri) in solutions of micelle-forming detergents are well-suited for this small-angle neutron scattering instrument, among others. Other biophysical characterization techniques are hindered by their inability to address the detergent contributions in a protein-detergent complex structure. Additionally, access to the Bio-Deuteration Lab provides unique capabilities for preparing large-scale cultivations and expressing deuterium-labeled proteins for enhanced scattering signal from the protein. While this technique does not provide structural details at high-resolution, the structural knowledge gap for membrane proteins contains many addressable areas of research without requiring near-atomic resolution. For example, these areas include determination of oligomeric states, complex formation, conformational changes during perturbation, and folding/unfolding events. These investigations can be readily accomplished through applications of this method.

Contrast-Matching Detergent in Small-Angle Neutron Scattering Experiments for Membrane Protein Structural Analysis and Ab Initio Modeling

This protocol demonstrates how to obtain a low-resolution ab initio model and structural details of a detergent-solubilized membrane protein in solution using small-angle neutron scattering with contrast-matching of the detergent.

막 단백질 구조 분석 및 Ab 론 적 모델링 작은 각 중성자 산란 실험에서 일치 하는 대비 세제

The biological small-angle neutron scattering instrument at the High-Flux Isotope Reactor of Oak Ridge National Laboratory is dedicated to the ...

Membrane-SPINE: A Biochemical Tool to Identify Protein-protein Interactions of Membrane Proteins In Vivo

Membrane proteins are essential for cell viability and are therefore important therapeutic targets1-3. Since they function in complexes4, methods to identify and characterize their interactions are necessary5. To this end, we developed the Membrane Strep-protein interaction experiment, called Membrane-SPINE6. This technique combines in vivo cross-linking using the reversible cross-linker formaldehyde with affinity purification of a Strep-tagged membrane bait protein. During the procedure, cross-linked prey proteins are co-purified with the membrane bait protein and subsequently separated by boiling. Hence, two major tasks can be executed when analyzing protein-protein interactions (PPIs) of membrane proteins using Membrane-SPINE: first, the confirmation of a proposed interaction partner by immunoblotting, and second, the identification of new interaction partners by mass spectrometry analysis. Moreover, even low affinity, transient PPIs are detectable by this technique. Finally, Membrane-SPINE is adaptable to almost any cell type, making it applicable as a powerful screening tool to identify PPIs of membrane proteins.

Membrane-SPINE: A Biochemical Tool to Identify Protein-protein Interactions of Membrane Proteins In Vivo

A biochemical approach is described to identify in vivo protein-protein interactions (PPI) of membrane proteins. The method combines protein cross-linking, affinity purification and mass spectrometry, and is adaptable to almost any cell type or organism. With this approach, even the identification of transient PPIs becomes possible.

막 척추 : 막 단백질의 단백질 - 단백질 상호 작용을 식별 할 수있는 생화학 적 도구<em&gt; 생체</em

Membrane proteins are essential for cell viability and are therefore important therapeutic targets1-3. Since they function in complexes4, methods to ...

생체공학

Evaluation of Protein&#8211;Protein Interactions using an On-Membrane Digestion Technique

Numerous intracellular proteins physically interact in accordance with their intracellular and extracellular circumstances. Indeed, cellular functions largely depend on intracellular protein&#8211;protein interactions. Therefore, research regarding these interactions is indispensable to facilitating the understanding of physiologic processes. Co-precipitation of associated proteins, followed by mass spectrometry (MS) analysis, enables the identification of novel protein interactions. In this study, we have provided details of the novel technique of immunoprecipitation-liquid chromatography (LC)-MS/MS analysis combined with on-membrane digestion for the analysis of protein&#8211;protein interactions. This technique is suitable for crude immunoprecipitants and can improve the throughput of proteomic analyses. Tagged recombinant proteins were precipitated using specific antibodies; next, immunoprecipitants blotted onto polyvinylidene difluoride membrane pieces were subjected to reductive alkylation. Following trypsinization, the digested protein residues were analyzed using LC-MS/MS. Using this technique, we were able to identify several candidate associated proteins. Thus, this method is convenient and useful for the characterization of novel protein&#8211;protein interactions.

Here, we present a protocol for an on-membrane digestion technique for the preparation of samples for mass spectrometry. This technique facilitates the convenient analysis of protein&#8211;protein interactions.

온-막 소화 기술을 사용한 단백질-단백질 상호 작용의 평가

Numerous intracellular proteins physically interact in accordance with their intracellular and extracellular circumstances. Indeed, cellular functions ...

Use of Microscale Thermophoresis to Measure Protein-Lipid Interactions

The ability to determine the binding affinity of lipids to proteins is an essential part of understanding protein-lipid interactions in membrane trafficking, signal transduction and cytoskeletal remodeling. Classic tools for measuring such interactions include surface plasmon resonance (SPR) and isothermal titration calorimetry (ITC). While powerful tools, these approaches have setbacks. ITC requires large amounts of purified protein as well as lipids, which can be costly and difficult to produce. Furthermore, ITC as well as SPR are very time consuming, which could add significantly to the cost of performing these experiments. One way to bypass these restrictions is to use the relatively new technique of microscale thermophoresis (MST). MST is fast and cost effective using small amounts of sample to obtain a saturation curve for a given binding event. There currently are two types of MST systems available. One type of MST requires labeling with a fluorophore in the blue or red spectrum. The second system relies on the intrinsic fluorescence of aromatic amino acids in the UV range. Both systems detect the movement of molecules in response to localized induction of heat from an infrared laser. Each approach has its advantages and disadvantages. Label-free MST can use untagged native proteins; however, many analytes, including pharmaceuticals, fluoresce in the UV range, which can interfere with determination of accurate KD values. In comparison, labeled MST allows for a greater diversity of measurable pairwise interactions utilizing fluorescently labeled probes attached to ligands with measurable absorbances in the visible range as opposed to UV, limiting the potential for interfering signals from analytes.

Microscale thermophoresis obtains binding constants quickly at low material cost. Either labeled or label free microscale thermophoresis is commercially available; however, label free thermophoresis is not capable of the diversity of interaction measurements that can be performed using fluorescent labels. We provide a protocol for labeled thermophoresis measurements.

단백질-지질 상호작용을 측정하기 위한 마이크로스케일 열영동 사용

The ability to determine the binding affinity of lipids to proteins is an essential part of understanding protein-lipid interactions in membrane ...

PeptiQuick, a One-Step Incorporation of Membrane Proteins into Biotinylated Peptidiscs for Streamlined Protein Binding Assays

Membrane proteins, including transporters, channels, and receptors, constitute nearly one-fourth of the cellular proteome and over half of current drug targets. Yet, a major barrier to their characterization and exploitation in academic or industrial settings is that most biochemical, biophysical, and drug screening strategies require these proteins to be in a water-soluble state. Our laboratory recently developed the peptidisc, a membrane mimetic offering a &#8220;one-size-fits-all&#8221; approach to the problem of membrane protein solubility. We present here a streamlined protocol that combines protein purification and peptidisc reconstitution in a single chromatographic step. This workflow, termed PeptiQuick, allows for bypassing dialysis and incubation with polystyrene beads, thereby greatly reducing exposure to detergent, protein denaturation, and sample loss. When PeptiQuick is performed with biotinylated scaffolds, the preparation can be directly attached to streptavidin-coated surfaces. There is no need to biotinylate or modify the membrane protein target. PeptiQuick is showcased here with the membrane receptor FhuA and antimicrobial ligand colicin M, using biolayer interferometry to determine the precise kinetics of their interaction. It is concluded that PeptiQuick is a convenient way to prepare and analyze membrane protein-ligand interactions within one&#160;day in a detergent-free environment.

We present a method that combines membrane protein purification and reconstitution into peptidiscs in a single chromatographic step. Biotinylated scaffolds are used for direct surface attachment and measurement of protein-ligand interactions via biolayer interferometry.

PeptiQuick, 간소화 된 단백질 결합 검정을 위한 생체 면역 펩티디스크에 막 단백질의 한 단계 통합

Membrane proteins, including transporters, channels, and receptors, constitute nearly one-fourth of the cellular proteome and over half of current drug ...

Native Cell Membrane Nanoparticles System for Membrane Protein-Protein Interaction Analysis

Protein-protein interactions in cell membrane systems play crucial roles in a wide range of biological processes- from cell-to-cell interactions to signal transduction; from sensing environmental signals to biological response; from metabolic regulation to developmental control. Accurate structural information of protein-protein interactions is crucial for understanding the molecular mechanisms of membrane protein complexes and for the design of highly specific molecules to modulate these proteins. Many in vivo and in vitro approaches have been developed for the detection and analysis of protein-protein interactions. Among them the structural biology approach is unique in that it can provide direct structural information of protein-protein interactions at the atomic level. However, current membrane protein structural biology is still largely limited to detergent-based methods. The major drawback of detergent-based methods is that they often dissociate or denature membrane protein complexes once their native lipid bilayer environment is removed by detergent molecules. We have been developing a&#160;native cell membrane nanoparticle system for membrane protein structural biology. Here, we demonstrate the use of this system in the analysis of protein-protein interactions on the cell membrane with a case study of the oligomeric state of AcrB.

Presented here is a protocol for the determination of oligomeric state of membrane proteins that utilizes a native cell membrane nanoparticle system in conjunction with electron microscopy.

멤브레인 단백질-단백질 상호 작용 분석을 위한 기본 세포막 나노입자 시스템

Protein-protein interactions in cell membrane systems play crucial roles in a wide range of biological processes- from cell-to-cell interactions to signal ...

In-vivo Detection of Protein-protein Interactions on Micro-patterned Surfaces

Unraveling the interaction network of molecules in-vivo is key to understanding the mechanisms that regulate cell function and metabolism. A multitude of methodological options for addressing molecular interactions in cells have been developed, but most of these methods suffer from being rather indirect and therefore hardly quantitative. On the contrary, a few high-end quantitative approaches were introduced, which however are difficult to extend to high throughput. To combine high throughput capabilities with the possibility to extract quantitative information, we recently developed a new concept for identifying protein-protein interactions (Schwarzenbacher et al., 2008). Here, we describe a detailed protocol for the design and the construction of this system which allows for analyzing interactions between a fluorophore-labeled protein ("prey") and a membrane protein ("bait") in-vivo. Cells are plated on micropatterned surfaces functionalized with antibodies against the bait exoplasmic domain. Bait-prey interactions are assayed via the redistribution of the fluorescent prey. The method is characterized by high sensitivity down to the level of single molecules, the capability to detect weak interactions, and high throughput capability, making it applicable as screening tool.

In-vivo Detection of Protein-protein Interactions on Micro-patterned Surfaces

This video shows experiments with subsequent analysis of protein-protein interactions by the use of micro-patterned surfaces. The approach offers the possibility to detect protein interactions in living cells and combines high throughput capabilities with the possibility to extract quantitative information.

마이크로 패턴의 표면에 단백질 - 단백질 상호 작용에 - 생체내 감지

Unraveling the interaction network of molecules in-vivo is key to understanding the mechanisms that regulate cell function and metabolism. A multitude of ...

생물학

Protein Membrane Overlay Assay: A Protocol to Test Interaction Between Soluble and Insoluble Proteins in vitro

Validating interactions between different proteins is vital for investigation of their biological functions on the molecular level. There are several methods, both in vitro and in vivo, to evaluate protein binding, and at least two methods that complement the shortcomings of each other should be conducted to obtain reliable insights. 
For an in vivo assay, the bimolecular fluorescence complementation (BiFC) assay represents the most popular and least invasive approach that enables to detect protein-protein interaction within living cells, as well as identify the intracellular localization of the interacting proteins 1,2. In this assay, non-fluorescent N- and C-terminal halves of GFP or its variants are fused to tested proteins, and when the two fusion proteins are brought together due to the tested proteins&#x2019; interactions, the fluorescent signal is reconstituted3-6. Because its signal is readily detectable by epifluorescence or confocal microscopy, BiFC has emerged as a powerful tool of choice among cell biologists for studying about protein-protein interactions in living cells 3. This assay, however, can sometimes produce false positive results. For example, the fluorescent signal can be reconstituted by two GFP fragments arranged as far as 7 nm from each other due to close packing in a small subcellular compartment, rather that due to specific interactions7.
Due to these limitations, the results obtained from live cell imaging technologies should be confirmed by an independent approach based on a different principle for detecting protein interactions. Co-immunoprecipitation (Co-IP) or glutathione transferase (GST) pull-down assays represent such alternative methods that are commonly used to analyze protein-protein interactions in vitro. However, iIn these assays, however, the tested proteins must be readily soluble in the buffer that supportsused for the binding reaction. Therefore, specific interactions involving an insoluble protein cannot be assessed by these techniques.
 Here, we illustrate the protocol for the protein membrane overlay binding assay, which circumvents this difficulty. In this technique, interaction between soluble and insoluble proteins can be reliably tested because one of the proteins is immobilized on a membrane matrix. This method, in combination with in vivo experiments, such as BiFC, provides a reliable approach to investigate and characterize interactions faithfully between soluble and insoluble proteins. In this article, binding between Tobacco mosaic virus (TMV) movement protein (MP), which exerts multiple functions during viral cell-to-cell transport8-14, and a recently identified plant cellular interactor, tobacco ankyrin repeat-containing protein (ANK) 15, is demonstrated using this technique.

Protein Membrane Overlay Assay: A Protocol to Test Interaction Between Soluble and Insoluble Proteins in vitro

Testing protein-protein interaction is indispensable for dissection of protein functionality. Here, we introduce an in vitro protein-protein binding assay to probe a membrane-immobilized protein with a soluble protein. This assay provides a reliable method to test interaction between an insoluble protein and a protein in solution.

단백질 막 중첩 분석 : 가용성식이 및 불용성 단백질 간의 상호 작용을 테스트하는 프로토콜 체외에서</em

Validating interactions between different proteins is vital for investigation of their biological functions on the molecular level.  There are several ...

Fluorescence-Detection Size-Exclusion Chromatography: A Technique to Identify the Integrity of Fluorescent Membrane Proteins upon Detergent Solubilization

Source: Bird, L. E., et al. <a href="https://www.jove.com/v/52357">Green Fluorescent Protein-based Expression Screening of Membrane Proteins in Escherichia coli</a>. J. Vis. Exp. (2015)
In this video, we demonstrate a fluorescence-detection size-exclusion chromatography technique to screen for green fluorescent protein (GFP)-fused membrane protein stability in Escherichia coli following detergent solubilization. Proteins exhibiting a symmetrical peak in the size-exclusion profile with little or no free GFP indicate purified proteins with minimum degradation and aggregation, which can subsequently be selected for structure-function analysis.

Fluorescence-Detection Size-Exclusion Chromatography: A technique to Identify the Integrity of Fluorescent Membrane Proteins on Detergent Solubilization(형광 검출 크기 배제 크로마토그래피: 세제 용해 시 형광 멤브레인 단백질의 무결성을 확인하는 기술)

Source: Bird, L. E., et al. Green Fluorescent Protein-based Expression Screening of Membrane Proteins in Escherichia coli. J. Vis. Exp. (2015)
In this ...