Name: quadruple immunostaining of the olfactory bulb for visualization of olfactory sensory axon molecular identity codes
Uploaded: 2017-06-05T15:00:00.000+00:00
Duration: 6 min 32 s
Description: Watch this Scientific Journal Video about Quadruple Immunostaining of the Olfactory Bulb for Visualization of Olfactory Sensory Axon Molecular Identity Codes at JoVE.com

이 작품은 Mitsubishi Foundation, 다케다 과학 재단, JST PRESTO 및 JSPS KAKENHI 부여 번호 16H06144에 의해 지원되었습니다.

모든 실험 절차는 도쿄 대학의 동물 실험 윤리위원회의 승인과 실험실 동물의 관리 및 사용에 대한 도쿄 대학의 지침에 따라 수행되었습니다. 1. 솔루션 준비 <ol><li> 0.01 M 인산염 완충 식염수 (PBS)를 준비합니다 : PBS 정제 (0.14 M NaCl, 0.0027 M KCl, 0.010 M PO 4 3- , pH 7.4)를 증류수 1 L에 넣고 완전히 용해 될 때까지 실온에서 저어줍니다. </li><li> PBS에 4 % 파라 포름 알데히드 (PFA)를 준비합니다 : 100 ML PBS에 4g의 PFA를 추가합니다. 그것이 완전히 녹을 때까지 60 ° C에서 용액을 저어 준다. <ol><li> PBS에 PFA를 용해시킨 후, 1N 수산화 나트륨 (NaOH)으로 용액의 pH를 7.4로 조절한다. 그런 다음 얼음으로 식힌 다음 여과지를 통해 용액을 여과하여 미립자 물질을 제거합니다. 4 ° C에서 보관하십시오. 주의 :이 시약을 사용할 때는 적절한주의를 기울이십시오. 핸들장갑, 안전 안경 및 화학 물질 두건 아래 실험실 코트를 조심스럽게 사용하십시오. 참고 : 2 일 이내에 준비된 신선한 4 % PFA 용액을 사용하십시오. </li></ol></li><li> 0.3 % Triton X - 100 (PBST)가 보충 된 0.01M PBS를 준비하십시오 : PBS의 997 ML에 트리톤 X - 100 3 ML을 추가합니다. 용액이 완전히 녹을 때까지 실온에서 교반하십시오. </li><li> 1 % 및 5 % 블로킹 용액을 준비한다 : 탈지유 10g을 PBST 200mL에 넣고 5 % 블로킹 용액을 만든다. 그것이 완전히 녹을 때까지 실온에서 교반하십시오. PBST로 5 % 블로킹 용액을 5 번 희석하여 1 % 블로킹 용액을 제조한다. </li></ol> 2. Parasagittal OB 섹션의 준비 <ol><li> 1 ~ 2 주령의 동물을 사용하십시오. 사구체가 명확하게 보이고 두개골로 뇌를 절단 할 수 있기 때문에이 연령대는 다음 실험에 적합합니다. </li><li> pentobarbital (50 MG / kg 체중)의 intraperitoneal 주사로 동물을 마취. 얼음 냉 4 % P로 동물을 경련 주사한다.PBS의 FA. 조심해서 다루고 화학 물질 두건 아래에 장갑, 안전 고글 및 실험실 코트를 사용하십시오. </li><li> 관류 후 가위로 머리를 잘라 피부를 조심스럽게 제거하십시오. 그런 다음 가위 칼날을 위턱과 아래턱 사이의 공간에 삽입하고 수평으로 자르면서 아래턱을 제거합니다. OB 및 OE를 포함하여 후각 조직을 떠나려면 집게 및 가위로 과도한 조직을 정리하십시오. 참고 : OB를 둘러싸고있는 두개골을 제거하지 마십시오. 이것은 중간 사구체를 수직으로 똑바로 유지하기 때문에 OB를 둘러싼 두개골을 제거하지 마십시오. </li><li> 비강에있는 공기를 제거하기 위해 PBS에 후각 조직을 담그십시오. 뇌의 후부를 수직으로 잘라 내고 후각 조직을 삽입면의 아래쪽에 삽입하십시오. 몰드에 Optimal Cutting Temperature (OCT) 화합물을 채우고 액체 질소에 몰드를 담그십시오. <ol><li> 화합물에있는 조직이 완전히 얼린 후에, 그것을 cryos에서 품어 라.-20 ℃에서 1 시간 동안 배양한다. </li></ol></li><li> 저온 유지 장치를 사용하여 OB의 직렬 parasagittal 섹션 (10 μm)을 만들고 MAS 코팅 유리 슬라이드에 부착하여 수집하십시오. 붙인 후 즉시 블로 드라이어로 슬라이드를 건조하십시오. </li></ol> 3. 1 일째 : OB 슬라이스의 4 배 Immunostaining <ol><li> RT에서 PBS로 5 분 슬라이드를 씻으십시오. 3 번 반복하십시오. </li><li> 실온에서 5 % 차단 솔루션과 슬라이드를 1 시간 품어 비특이적 인 바인딩 사이트를 차단합니다. </li><li> RT에서 1 % 차단 솔루션의 기본 항체 (각 슬라이드 400 μL)의 칵테일과 O / N 슬라이드를 품어. 기니피그 항 Kirrel2 항체 (1 : 1000), 염소 항 세마포린 -7A (Sema7A) 항체 (1 : 500), 래트 항 -OL- 프로토 커 들린 (OLPC) 항체 (1 : 500) 및 마우스 항 - 소 혈청 글루타메이트 트랜스 포터 2 (VGLUT2) 항체 (1 : 500). </li></ol> 4. 2 일째 : OB의 4 배 Immunostaining조각 <ol><li> 일차 항체 용액을 버리고 RT에서 PBST로 5 분 동안 슬라이드를 씻으십시오. 3 번 반복하십시오. </li><li> RT에서 PBS의 보조 항체 (각 슬라이드 400 μL)의 칵테일과 1 시간 슬라이드를 품어. 당나귀 항 마우스 Alexa Fluor 405 (1 : 400), 당나귀 방제 Alexa Fluor 488 (1 : 400), 당나귀 항 기니아 피그 Alexa Fluor 555 (1 : 400) 및 당나귀 항 - 쥐 Alexa Fluor 647 (1 : 400). 참고 : 모든 2 차 항체는 동일한 숙주에서 유래한다. 파장이 겹치지 않도록 각 1 차 항체에 대한 2 차 항체의 형광 파장을 선택하십시오. </li><li> 솔루션을 폐기하고 RT에서 PBS로 5 분 슬라이드를 씻으십시오. 3 번 반복하십시오. </li><li> 마운트 매체로 슬라이드에 coverslips를 마운트합니다. 이를 위해, 각 슬라이드에 장착 매체 2 방울을 적용한 다음, 기포를 제거하여 coverslip을 넣어. </li></ol> 5. 강도 Me의구심 <ol><li> 형광 현미경으로 형광 이미지를 얻습니다. Alexa Fluor 405 신호, GFP 필터 큐브 (470/40 nm 여기, 525/50 nm 방출, 500 nm 방출, 400 nm 다이크로 익 미러)에 대해 DAPI 필터 큐브 (360/40 nm 여기, 460/50 nm 방사 및 400 nm 다이크로 익 미러) 및 495 nm 다이크로 익 미러), Alexa Fluor 555 용 TRITC 필터 큐브 (545/25 nm 여기, 605/70 nm 방출 및 565 nm 다이크로 익 미러) 및 Cy5 필터 큐브 (620/60 nm 여기, 700 / 75 nm emission, 600 nm dichroic mirror)을 Alexa Fluor 647에 적용했습니다. 참고 : 채도가없는 이미지의 형광 신호를 얻으려면 노출 시간을 조정하십시오. </li><li> VGLUT2의 immunofluorescence 신호로 사구체 구조를 정의하십시오. ImageJ로 사구체 내 축삭 정렬 분자의 염색 강도를 측정합니다. </li></ol> 6. 데이터 분석 <ol><li> 축삭 정렬 분자의 얼룩 강도에서 배경 신호를 뺍니다. </li><li> 준비하기e 발현 데이터 매트릭스는 축삭 정렬 분자로 구성된 컬럼과 사구체로 구성된 행을 갖는다. </li><li> 준비된 표현 데이터 세트를 사용하여 주성분 분석 (PCA)을 수행하십시오. 그런 다음 각 주 구성 요소의 PCA 점수, 기여도 비율 및 요인 부하를 얻습니다. </li></ol>

<ol>
	<li>Mori, K., Sakano, H. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=How+is+the+olfactory+map+formed+and+interpreted+in+the+mammalian+brain?.">How is the olfactory map formed and interpreted in the mammalian brain?.</a> Annu Rev Neurosci. 34, 467-499 (2011).</li><li>Takeuchi, H., Sakano, H. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Neural+map+formation+in+the+mouse+olfactory+system.">Neural map formation in the mouse olfactory system.</a> Cell Mol Life Sci. 71, 3049-3057 (2014).</li><li>Mombaerts, P., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Visualizing+an+olfactory+sensory+map.">Visualizing an olfactory sensory map.</a> Cell. 87, 675-686 (1996).</li><li>Feinstein, P., Mombaerts, P. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=A+contextual+model+for+axonal+sorting+into+glomeruli+in+the+mouse+olfactory+system.">A contextual model for axonal sorting into glomeruli in the mouse olfactory system.</a> Cell. 117, 817-831 (2004).</li><li>Ishii, T., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Monoallelic+expression+of+the+odourant+receptor+gene+and+axonal+projection+of+olfactory+sensory+neurones.">Monoallelic expression of the odourant receptor gene and axonal projection of olfactory sensory neurones.</a> Genes Cell. 6, 71-78 (2001).</li><li>Nakashima, A., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Agonist-independent+GPCR+activity+regulates+anterior-posterior+targeting+of+olfactory+sensory+neurons.">Agonist-independent GPCR activity regulates anterior-posterior targeting of olfactory sensory neurons.</a> Cell. 154, 1314-1325 (2013).</li><li>Serizawa, S., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=A+neuronal+identity+code+for+the+odorant+receptor-specific+and+activity-dependent+axon+sorting.">A neuronal identity code for the odorant receptor-specific and activity-dependent axon sorting.</a> Cell. 127, 1057-1069 (2006).</li><li>Kaneko-Goto, T., Yoshihara, S., Miyazaki, H., Yoshihara, Y. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=BIG-2+mediates+olfactory+axon+convergence+to+target+glomeruli.">BIG-2 mediates olfactory axon convergence to target glomeruli.</a> Neuron. 57, 834-846 (2008).</li><li>Ihara, N., Nakashima, A., Hoshina, N., Ikegaya, Y., Takeuchi, H. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Differential+expression+of+axon-sorting+molecules+in+mouse+olfactory+sensory+neurons.">Differential expression of axon-sorting molecules in mouse olfactory sensory neurons.</a> Eur J Neuro. 44, 1998-2003 (2016).</li><li>Williams, E. O., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Delta+Protocadherin+10+is+Regulated+by+Activity+in+the+Mouse+Main+Olfactory+System.">Delta Protocadherin 10 is Regulated by Activity in the Mouse Main Olfactory System.</a> Front Neural Circuits. 5, 9 (2011).</li><li>Brunet, L. J., Gold, G. H., Ngai, J. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=General+anosmia+caused+by+a+targeted+disruption+of+the+mouse+olfactory+cyclic+nucleotide-gated+cation+channel.">General anosmia caused by a targeted disruption of the mouse olfactory cyclic nucleotide-gated cation channel.</a> Neuron. 17, 681-693 (1996).</li></ol>

저자는 경쟁적인 금전적 이해 관계가 없음을 선언합니다.

parasagittal OB 섹션의 4 배 면역 염색은 많은 수의 사구체에서 동시에 4 개의 축삭 정렬 분자의 발현 수준을 시각화하고 정량화 할 수있었습니다. 이러한 다변량 데이터를 PCA로 분석함으로써 이들 분자의 발현 특성을 추측 할 수 있습니다. 성공적인 염색을 위해서는 조직 샘플 준비가 매우 중요합니다. 일부 프로토콜은 조직을 4 % PFA로 후 고정시키고 cryoprotection을 위해 30 % sucrose...

개발하는 동안, 뉴런은 서로 정확하게 연결되어 정상적인 뇌 기능에 중요한 적절한 신경 회로를 형성합니다. 뇌의 비정상적인 신경 회로는 자폐증 및 정신 분열증과 같은 정신 장애의 원인으로 여겨지므로 신경 회로 형성 메커니즘을 이해하는 것이 신경 과학 분야의 주요 과제 중 하나입니다. 마우스 후각 시스템에서 Olfactory Epithelium (OE)의 각 감각 신경 세포 (OSN)는 오직 하나의 기능적 후각 수용체 (OR) 유전자를 발현하고 동일한 OR을 발현하는 OSNs는 축색 돌기의 고정 된 위치에서 사구체의 특정 쌍에 축삭을 수렴시킵니다. 후각 망막 (OB) 1 , 2 . 마우스 후각 시스템은 신경 회로 형성의 분자 메커니즘을 연구하기위한 훌륭한 모델 시스템입니다. 연구자는 OR 표현을 활용하여 특정 s를 식별 할 수 있기 때문에OSNs의 ubtype과 명확한 사구체 구조로 OSN axons의 투영 사이트를 시각화. OSN 예측의 주목할만한 특징은 OR이 OSN 축색 돌기를 OB 3 , 4 , 5 , 6 에 투사 할 때 중요한 역할을한다는 점입니다. 보다 구체적으로, OSN 축삭 돌기가 표적 부위를 대략적으로 안내 한 후에, 이들은 분리되어 OR 의존성 방식으로 사구체를 형성한다. 이전의 연구는 OR 분자가 사구체 분리를 조절하는 축삭 정렬 분자의 발현을 조절한다는 것을 보여 주었다. 더욱이 축적 된 증거에 따르면 OR 분자는 축삭 정렬 분자의 독특한 조합에 의해 신경 신원 코드를 생성한다. 따라서, OR 의존성 사구체 분리의 메커니즘을 이해하기 위해서는 axon-sorting mol의 발현 프로파일을 특성화 할 필요가있다OSNs의 ecules. 형광 면역 염색은 특정 유전자의 발현을 시각화하는 일반적인 방법입니다. axon-sorting 분자의 단백질은 주로 OSN 축삭에 국한되어 있기 때문에 연구자들은 OBN을 이용하여 OSN에서의 발현 양상을 분석 할 필요가있다. OB의 관상 절편은 면역 염색에 일상적으로 사용되었습니다. 그러나,이 준비는 같은 OB 섹션에서 전후 축을 따라 지형 정보를 잃습니다. 따라서 우리는 OB의 내측의 parasagittal 준비를 개발했다. 이것은 같은 OB 구역에서 가능한 한 많은 주변 사구를 장착 할 수있다. 여러 항체를 이용한 면역 염색과 결합하여, OB 절 사이의 염색 변이없이 축삭 정렬 분자의 발현 양상을 비교 분석 할 수 있습니다. 또한, 면역 조직 화학 염색 방법은 PFA a와 함께 고정 후 (post-fixation)없이 제시되었다자당 치료. 이 방법을 통해 연구자는 다 변수 데이터 분석을위한 고품질의 염색 데이터를 얻을 수 있습니다. 여기에 제시된 프로토콜은 후각 신경 회로 형성을 연구하는 연구자에게 강력한 방법에 대한 세부 정보를 제공합니다.

<table><tbody><tr><td>Phosphate-Buffered Saline (PBS) Tablets, pH7.4</td><td>TAKARA BIO</td><td>T9181</td><td></td></tr><tr><td>Skim Milk</td><td>nacalai tesque</td><td>31149-75</td><td></td></tr><tr><td>goat anti-Sema7A antibody</td><td>R&amp;amp;D Systems</td><td>AF2068</td><td></td></tr><tr><td>rat anti-OLPC antibody</td><td>Merck Millipore</td><td>MABT20</td><td></td></tr><tr><td>mouse anti-VGLUT2 antibody</td><td>Merck Millipore</td><td>MAB5504</td><td></td></tr><tr><td>goat anti-BIG-2 antibody</td><td>R&amp;amp;D Systems</td><td>AF2205</td><td></td></tr><tr><td>gunea pig anti-Kirrel2 antibody</td><td>Operon Biotechnologies</td><td></td><td>Anti-Kirrel2 antibodies were generated by immunizing guinea pigs with KLH-conjugated synthetic peptides (644-673aa): CRLYRARAGYLTTPHPRAFTSYMKPTSFGP</td></tr><tr><td>donkey anti-mouse Alexa Fluor 405</td><td>Abcam</td><td>ab175658</td><td></td></tr><tr><td>donkey anti-goat Alexa Fluor 488&amp;nbsp;</td><td>Jackson ImmunoResearch</td><td>705-545-003</td><td></td></tr><tr><td>donkey anti-guinea pig Alexa Fluor 555</td><td>Thermo Fisher Scientific</td><td>A21432</td><td></td></tr><tr><td>donkey anti-rat Alexa Fluor 647</td><td>Jackson ImmunoResearch</td><td>712-605-153</td><td></td></tr><tr><td>Paraformaldehyde (PFA)</td><td>Wako</td><td>162-16065</td><td></td></tr><tr><td>MAS coated slide glasses</td><td>MATSUNAMI</td><td>MAS-01</td><td></td></tr><tr><td>forceps</td><td>Fine Science Tools</td><td>11253-27</td><td></td></tr><tr><td>Vannas Spring Scissors</td><td>Fine Science Tools</td><td>15000-00</td><td></td></tr><tr><td>dissecting scissors</td><td>Fine Science Tools</td><td>14090-09</td><td></td></tr><tr><td>fluorescent microscope</td><td>KEYENCE</td><td>BZ-X700</td><td></td></tr><tr><td>DAPI filter cube</td><td>KEYENCE</td><td>OP-87762</td><td></td></tr><tr><td>GFP filter cube</td><td>KEYENCE</td><td>OP-87763</td><td></td></tr><tr><td>TRITC filter cube</td><td>KEYENCE</td><td>OP-87764</td><td></td></tr><tr><td>Cy5 filter cube</td><td>KEYENCE</td><td>OP-87766</td><td></td></tr><tr><td>filter paper</td><td>ADVANTEC</td><td>00011185</td><td></td></tr><tr><td>O.C.T compound</td><td>Sakura Finetek</td><td>M71484</td><td></td></tr></tbody></table>

quadruple immunostaining of the olfactory bulb for visualization of olfactory sensory axon molecular identity codes

마우스 후각 시스템은 간단한 해부학 구조로 인해 신경 회로 형성 메커니즘을 연구하는 데 자주 사용됩니다. 후각 감각 뉴런 (OSN)은 단일 수상 돌기 및 단일 비 축삭 축색 돌기가있는 양극성 세포입니다. OSN은 하나의 후각 수용체 (OR) 유전자 만 발현하며, 주어진 유형의 OR을 표현하는 OSN은 그들의 축색 돌기를 후각 망막 (OB)의 불변성 사구체에 수렴시킵니다. OSN 예측의 두드러진 특징은 표현 된 OR이 축삭 투영에서 중요한 역할을한다는 점입니다. OR는 다중 axon-sorting 분자의 발현을 조절하고 OSN 축삭 말단에서 axon-sorting 분자의 조합 분자 코드를 생성한다. 따라서, OR- 특정 axon 유도 메커니즘의 분자 메커니즘을 이해하기 위해서는 동일한 사구체 내의 OSN 축삭 말단에서 그들의 발현 프로파일을 특성화하는 것이 중요합니다. 이 기사의 목적은 가능한 많은 사구체를 수집하는 방법을 소개하는 것이 었습니다e를 단일 OB 부위에 투여하고 다중 항체를 사용하여 면역 염색을 수행한다. 이것은 OB 절 사이의 얼룩 변이없이 축색 - 정렬 분자의 발현 양상을 비교 분석 할 수있게한다.

후각 사구체지도는 OSN 축삭 1 , 2 의 초기 전역 표적화 및 사후 사구체 분리에 의해 형성됩니다. 사구체 분리는 ax / sorting 분자에 의해 매개되는 접착 성 / 반발 축삭 상호 작용에 의해 조절됩니다.이 분자의 발현 수준은 발현 된 OR 분자에 의해 결정됩니다. 사구체 분리에 관련된 axon-sorting 분자는 OB 9 에서 위치 ?...

Watch this Scientific Journal Video about Quadruple Immunostaining of the Olfactory Bulb for Visualization of Olfactory Sensory Axon Molecular Identity Codes at JoVE.com

Quadruple Immunostaining of the Olfactory Bulb for Visualization of Olfactory Sensory Axon Molecular Identity Codes

후각 감각 뉴런은 적절한 신경 회로를 만들기 위해 다양한 축삭 정렬 분자를 발현합니다. 이 프로토콜은 후각 감각 뉴런의 축삭 종말에 축삭 - 정렬 분자의 조합 표현을 시각화하기 위해 면역 조직 화학 염색법을 설명합니다.

후각 감각 축색 돌연변이 분자 식별 코드의 시각화를위한 뒷 전구의 4 배 면역 면역 측정법

The mouse olfactory system is often used to study mechanisms of neural circuit formation&#12288;because of its simple anatomical structure. An Olfactory ...

quadruple-immunostaining-olfactory-bulb-for-visualization-olfactory

Research

JoVE Journal

Neuroscience

7.0K 조회수.  The University of Tokyo.  후각 감각 뉴런은 적절한 신경 회로를 만들기 위해 다양한 축삭 정렬 분자를 발현합니다. 이 프로토콜은 후각 감각 뉴런의 축삭 종말에 축삭 - 정렬 분자의 조합 표현을 시각화하기 위해 면역 조직 화학 염색법을 설명합니다. 

비디오: Quadruple Immunostaining of the Olfactory Bulb for Visualization of Olfactory Sensory Axon Molecular Identity Codes

Lentivirus-mediated Genetic Manipulation and Visualization of Olfactory Sensory Neurons in vivo

Development of a precise olfactory circuit relies on accurate projection of olfactory sensory neuron (OSN) axons to their synaptic 
targets in the olfactory bulb (OB). The molecular mechanisms of OSN axon growth and targeting are not well understood. Manipulating gene expression and subsequent 
visualizing of single OSN axons and their terminal arbor morphology have thus far been challenging. To study gene function at the single cell level within a specified 
time frame, we developed a lentiviral based technique to manipulate gene expression in OSNs in vivo. Lentiviral particles are delivered to OSNs by microinjection 
into the olfactory epithelium (OE). Expression cassettes are then permanently integrated into the genome of transduced OSNs. Green fluorescent protein expression 
identifies infected OSNs and outlines their entire morphology, including the axon terminal arbor. Due to the short turnaround time between microinjection and 
reporter detection, gene function studies can be focused within a very narrow period of development. With this method, we have detected GFP expression within as 
few as three days and as long as three months following injection. We have achieved both over-expression and shRNA mediated knock-down by lentiviral microinjection. 
This method provides detailed morphologies of OSN cell bodies and axons at the single cell level in vivo, and thus allows characterization of candidate gene function 
during olfactory development.

Lentivirus-mediated Genetic Manipulation and Visualization of Olfactory Sensory Neurons in vivo

We present a lentiviral technique for genetic manipulation and visualization of single olfactory sensory neuron axon and its terminal arborization in vivo.

강한 감각 뉴런의 Lentivirus - 중재 유전자 조작 및 시각화 생체내에</em

Development of a precise olfactory circuit relies on accurate projection of olfactory sensory neuron (OSN) axons to their synaptic 
targets in the ...

연구

신경과학

Imaging Odor-Evoked Activities in the Mouse Olfactory Bulb using Optical Reflectance and Autofluorescence Signals

In the brain, sensory stimulation activates distributed populations of neurons among functional modules which participate to the coding of the stimulus. Functional optical imaging techniques are advantageous to visualize the activation of these modules in sensory cortices with high spatial resolution. In this context, endogenous optical signals that arise from molecular mechanisms linked to neuroenergetics are valuable sources of contrast to record spatial maps of sensory stimuli over wide fields in the rodent brain.
Here, we present two techniques based on changes of endogenous optical properties of the brain tissue during activation. First the intrinsic optical signals (IOS) are produced by a local alteration in red light reflectance due to: (i) absorption by changes in blood oxygenation level and blood volume (ii) photon scattering. The use of in vivo IOS to record spatial maps started in the mid 1980's with the observation of optical maps of whisker barrels in the rat and the orientation columns in the cat visual cortex1. IOS imaging of the surface of the rodent main olfactory bulb (OB) in response to odorants was later demonstrated by Larry Katz's group2. The second approach relies on flavoprotein autofluorescence signals (FAS) due to changes in the redox state of these mitochondrial metabolic intermediates. More precisely, the technique is based on the green fluorescence due to oxidized state of flavoproteins when the tissue is excited with blue light. Although such signals were probably among the first fluorescent molecules recorded for the study of brain activity by the pioneer studies of Britton Chances and colleagues3, it was not until recently that they have been used for mapping of brain activation in vivo. FAS imaging was first applied to the somatosensory cortex in rodents in response to hindpaw stimulation by Katsuei Shibuki's group4.
The olfactory system is of central importance for the survival of the vast majority of living species because it allows efficient detection and identification of chemical substances in the environment (food, predators). The OB is the first relay of olfactory information processing in the brain. It receives afferent projections from the olfactory primary sensory neurons that detect volatile odorant molecules. Each sensory neuron expresses only one type of odorant receptor and neurons carrying the same type of receptor send their nerve processes to the same well-defined microregions of &tilde;100&mu;m3 constituted of discrete neuropil, the olfactory glomerulus (Fig. 1). In the last decade, IOS imaging has fostered the functional exploration of the OB5, 6, 7 which has become one of the most studied sensory structures. The mapping of OB activity with FAS imaging has not been performed yet.
Here, we show the successive steps of an efficient protocol for IOS and FAS imaging to map odor-evoked activities in the mouse OB.

This article presents the protocols of intrinsic optical signals and flavoproteins autofluorescence signals imaging to map odor-evoked activities at the surface of the olfactory bulb in mice.

광 반사율과 Autofluorescence 신호를 사용하여 마우스 후각 망울에서 이미징 냄새 Evoked 활동

In the brain, sensory stimulation activates distributed populations of neurons among functional modules which participate to the coding of the stimulus. ...

Selective Viral Transduction of Adult-born Olfactory Neurons for Chronic in vivo Optogenetic Stimulation

Local interneurons are continuously regenerated in the olfactory bulb of adult rodents1-3. In this process, called adult neurogenesis, neural stem cells in the walls of the lateral ventricle give rise to neuroblasts that migrate for several millimeters along the rostral migratory stream (RMS) to reach and incorporate into the olfactory bulb. To study the different steps and the impact of adult-born neuron integration into preexisting olfactory circuits, it is necessary to selectively label and manipulate the activity of this specific population of neurons. The recent development of optogenetic technologies offers the opportunity to use light to precisely activate this specific cohort of neurons without affecting surrounding neurons4,5. Here, we present a series of procedures to virally express Channelrhodopsin2(ChR2)-YFP in a temporally restricted cohort of neuroblasts in the RMS before they reach the olfactory bulb and become adult-born neurons. In addition, we show how to implant and calibrate a miniature LED for chronic in vivo stimulation of ChR2-expressing neurons.

Selective Viral Transduction of Adult-born Olfactory Neurons for Chronic in vivo Optogenetic Stimulation

Adult-born neurons of the olfactory bulb can be optogenetically controlled using Channelrhodopsin2-expressing lentiviral injection in the rostral migratory stream and chronic photostimulation with an implanted miniature LED.

만성에 대한 성인 태어나 강한 뉴런의 선택 바이러스성 전달 생체내에 Optogenetic의 자극

Local interneurons are continuously regenerated in the olfactory bulb of adult rodents1-3. In this process, called adult neurogenesis, neural stem cells ...

Whole Mount Immunolabeling of Olfactory Receptor Neurons in the Drosophila Antenna

Odorant molecules bind to their target receptors in a precise and coordinated manner. Each receptor recognizes a specific signal and relays this information to the brain. As such, determining how olfactory information is transferred to the brain, modifying both perception and behavior, merits investigation. Interestingly, there is emerging evidence that cellular transduction and transcriptional factors are involved in the diversification of olfactory receptor neuron. Here we provide a robust whole mount immunological labeling method to assay in vivo olfactory receptor neuron organization. Using this method, we identified all olfactory receptor neurons with anti-ELAV antibody, a known pan-neural marker and Or49a-mCD8::GFP, an olfactory receptor neuron specifically expressed in Nba neuron using anti-GFP antibody.

Whole Mount Immunolabeling of Olfactory Receptor Neurons in the Drosophila Antenna

Herein we describe the process of whole mount immunostaining of Drosophila antennae, which enables us to better understand the molecular mechanisms involved in the diversification of olfactory receptor neurons (ORN)s.

에있는 후각 수용체 뉴런의 전체 마운트 Immunolabeling<em&gt; 초파리</em&gt; 안테나

Odorant molecules bind to their target receptors in a precise and coordinated manner. Each receptor recognizes a specific signal and relays this ...

The Olfactory System as a Model to Study Axonal Growth Patterns and Morphology In Vivo

The olfactory system has the unusual capacity to generate new neurons throughout the lifetime of an organism. Olfactory stem cells in the basal portion of the olfactory epithelium continuously give rise to new sensory neurons that extend their axons into the olfactory bulb, where they face the challenge to integrate into existing circuitry. Because of this particular feature, the olfactory system represents a unique opportunity to monitor axonal wiring and guidance, and to investigate synapse formation. Here we describe a procedure for in vivo labeling of sensory neurons and subsequent visualization of axons in the olfactory system of larvae of the amphibian Xenopus laevis. To stain sensory neurons in the olfactory organ we adopt the electroporation technique. In vivo electroporation is an established technique for delivering fluorophore-coupled dextrans or other macromolecules into living cells. Stained sensory neurons and their axonal processes can then be monitored in the living animal either using confocal laser-scanning or multiphoton microscopy. By reducing the number of labeled cells to few or single cells per animal, single axons can be tracked into the olfactory bulb and their morphological changes can be monitored over weeks by conducting series of in vivo time lapse imaging experiments. While the described protocol exemplifies the labeling and monitoring of olfactory sensory neurons, it can also be adopted to other cell types within the olfactory and other systems.

The Olfactory System as a Model to Study Axonal Growth Patterns and Morphology In Vivo

We describe a protocol for in vivo labeling of olfactory sensory neurons by electroporation and subsequent confocal laser-scanning or multiphoton microscopy to visualize neuronal morphology and its development over time.

모델로 후각 시스템은 축삭 성장 패턴 및 형태를 연구하는<em&gt; 생체</em

The olfactory system has the unusual capacity to generate new neurons throughout the lifetime of an organism. Olfactory stem cells in the basal portion of ...

Whole Mount Labeling of Cilia in the Main Olfactory System of Mice

The mouse olfactory system comprises 6-10 million olfactory sensory neurons in the epithelium lining the nasal cavity. Olfactory neurons extend a single dendrite to the surface of the epithelium, ending in a structure called dendritic knob. Cilia emanate from this knob into the mucus covering the epithelial surface. The proteins of the olfactory signal transduction cascade are mainly localized in the ciliary membrane, being in direct contact with volatile substances in the environment. For a detailed understanding of olfactory signal transduction, one important aspect is the exact morphological analysis of signaling protein distribution. Using light microscopical approaches in conventional cryosections, protein localization in olfactory cilia is difficult to determine due to the density of ciliary structures. To overcome this problem, we optimized an approach for whole mount labeling of cilia, leading to improved visualization of their morphology and the distribution of signaling proteins. We demonstrate the power of this approach by comparing whole mount and conventional cryosection labeling of Kirrel2. This axon-guidance adhesion molecule is known to localize in a subset of sensory neurons and their axons in an activity-dependent manner. Whole mount cilia labeling revealed an additional and novel picture of the localization of this protein.

Cilia of olfactory sensory neurons contain proteins of the signal transduction cascade, but a detailed spatial analysis of their distribution is difficult in cryosections. We describe here an optimized approach for whole mount labeling and en face visualization of ciliary proteins.

마우스의 메인 후각 시스템의 섬모의 전체 마운트 라벨링

The mouse olfactory system comprises 6-10 million olfactory sensory neurons in the epithelium lining the nasal cavity. Olfactory neurons extend a single ...

An Explant System for Time-Lapse Imaging Studies of Olfactory Circuit Assembly in Drosophila

~Neurons are precisely interconnected to form circuits essential for the proper function of the brain. The Drosophila olfactory system provides an excellent model to investigate this process since 50 types of olfactory receptor neurons (ORNs) from the antennae and maxillary palps project their axons to 50 identifiable glomeruli in the antennal lobe and form synaptic connections with dendrites from 50 types of second-order projection neurons (PNs). Previous studies mainly focused on identifying important molecules that regulate the precise targeting in the olfactory circuit using fixed tissues. Here, an antennae-brain explant system that recapitulates key developmental milestones of olfactory circuit assembly in culture is described. Through dissecting the external cuticle and cleaning opaque fat bodies covering the developing pupal brain, high quality images of single neurons from live brains can be collected using two-photon microscopy. This allows time-lapse imaging of single ORN axon targeting from live tissue. This approach will help reveal important cell biological contexts and functions of previously identified important genes and identify mechanisms underpinning the dynamic process of circuit assembly.

An Explant System for Time-Lapse Imaging Studies of Olfactory Circuit Assembly in Drosophila

This protocol describes the dissection procedure, culture condition, and live imaging of an antennae-brain explant system for the study of the olfactory circuit assembly.

초파리의 후각 회로 어셈블리의 타임랩스 이미징 연구를위한 Explant 시스템

~Neurons are precisely interconnected to form circuits essential for the proper function of the brain. The Drosophila olfactory system provides an ...

발생학

Recording Temperature-induced Neuronal Activity through Monitoring Calcium Changes in the Olfactory Bulb of Xenopus laevis

The olfactory system, specialized in the detection, integration and processing of chemical molecules is likely the most thoroughly studied sensory system. However, there is piling evidence that olfaction is not solely limited to chemical sensitivity, but also includes temperature sensitivity. Premetamorphic Xenopus laevis are translucent animals, with protruding nasal cavities deprived of the cribriform plate separating the nose and the olfactory bulb. These characteristics make them well suited for studying olfaction, and particularly thermosensitivity. The present article describes the complete procedure for measuring temperature responses in the olfactory bulb of X. laevis larvae. Firstly, the electroporation of olfactory receptor neurons (ORNs) is performed with spectrally distinct dyes loaded into the nasal cavities in order to stain their axon terminals in the bulbar neuropil. The differential staining between left and right receptor neurons serves to identify the &#947;-glomerulus as the only structure innervated by contralateral presynaptic afferents. Secondly, the electroporation is combined with focal bolus loading in the olfactory bulb in order to stain mitral cells and their dendrites. The 3D brain volume is then scanned under line-illumination microscopy for the acquisition of fast calcium imaging data while small temperature drops are induced at the olfactory epithelium. Lastly, the post-acquisition analysis allows the morphological reconstruction of the thermosensitive network comprising the &#947;-glomerulus and its innervating mitral cells, based on specific temperature-induced Ca2+ traces. Using chemical odorants as stimuli in addition to temperature jumps enables the comparison between thermosensitive and chemosensitive networks in the olfactory bulb.

Recording Temperature-induced Neuronal Activity through Monitoring Calcium Changes in the Olfactory Bulb of Xenopus laevis

Here we describe a protocol for measuring and analyzing temperature responses in the olfactory bulb of Xenopus laevis. Olfactory receptor neurons and mitral cells are differentially stained, after which calcium changes are recorded, reflecting a sensitivity of some neural networks in the bulb to temperature drops induced at the nose.

의 후각 망울에서 칼슘의 변경 사항을 모니터링을 통해 온도에 의한 신경 세포의 활동을 기록<em&gt; Xenopus의의 laevis의</em

The olfactory system, specialized in the detection, integration and processing of chemical molecules is likely the most thoroughly studied sensory system. ...

Functional Evaluation of Olfactory Pathways in Living Xenopus Tadpoles

Xenopus tadpoles offer a unique platform to investigate the function of the nervous system. They provide multiple experimental advantages, such as accessibility to numerous imaging approaches, electrophysiological techniques and behavioral assays. The Xenopus tadpole olfactory system is particularly well suited to investigate the function of synapses established during normal development or reformed after injury. Here, we describe methodologies to evaluate the processing of olfactory information in living Xenopus larvae. We outline a combination of in vivo measurements of presynaptic calcium responses in glomeruli of the olfactory bulb with olfactory-guided behavior assays. Methods can be combined with the transection of olfactory nerves to study the rewiring of synaptic connectivity. Experiments are presented using both wild-type and genetically modified animals expressing GFP reporters in central nervous system cells. Application of the approaches described to genetically modified tadpoles can be useful for unraveling the molecular bases that define vertebrate behavior.

Functional Evaluation of Olfactory Pathways in Living Xenopus Tadpoles

Xenopus tadpoles offer a unique platform to investigate the function of the nervous system in vivo. We describe methodologies to evaluate the processing of olfactory information in living Xenopus larvae in normal rearing conditions or after injury.

생활 Xenopus Tadpoles에 후 각 통로의 기능 평가

Xenopus tadpoles offer a unique platform to investigate the function of the nervous system. They provide multiple experimental advantages, such as ...

Investigation of Activated Mouse Olfactory Sensory Neurons via Combined Immunostaining and in situ Hybridization

Animals rely on chemical communication to convey and perceive relevant environmental information, ranging from assessment of food quality to detection of available mating partners or threats. In mice, this task is executed primarily by the olfactory system and its underlying subsystems, including the main and accessory olfactory systems. Both have peripheral organs populated by sensory neurons expressing G-protein coupled receptors able to bind chemical cues that reach the nasal cavity. Even though the molecular characteristics of these receptors is well understood, little is known about their cognate specific ligands. The method described here combines in situ hybridization detection of olfactory or vomeronasal receptors with immunodetection of phosphorylated ribosomal protein S6 (pS6) - a marker of neuronal activation. This protocol was devised to identify neurons activated after a single event of exposure to purified or complex chemical stimuli detected by the olfactory organs. Importantly, this technique allows the investigation of neurons triggered in biologically relevant contexts. Ideally, this method should be used to probe the molecular biology of the olfactory system and to study olfactory behaviors.

Investigation of Activated Mouse Olfactory Sensory Neurons via Combined Immunostaining and in situ Hybridization

This protocol combines in situ hybridization with immunofluorescence to identify olfactory and vomeronasal receptor genes expressed in olfactory sensory neurons after activation by chemical stimuli in the mouse.

Animals rely on chemical communication to convey and perceive relevant environmental information, ranging from assessment of food quality to detection of ...

후각 감각 축색 돌연변이 분자 식별 코드의 시각화를위한 뒷 전구의 4 배 면역 면역 측정법

요약

더 많은 비디오 탐색

이 비디오의 챕터

강한 감각 뉴런의 Lentivirus - 중재 유전자 조작 및 시각화 생체내에

광 반사율과 Autofluorescence 신호를 사용하여 마우스 후각 망울에서 이미징 냄새 Evoked 활동

만성에 대한 성인 태어나 강한 뉴런의 선택 바이러스성 전달 생체내에 Optogenetic의 자극

에있는 후각 수용체 뉴런의 전체 마운트 Immunolabeling

모델로 후각 시스템은 축삭 성장 패턴 및 형태를 연구하는

마우스의 메인 후각 시스템의 섬모의 전체 마운트 라벨링

초파리의 후각 회로 어셈블리의 타임랩스 이미징 연구를위한 Explant 시스템

의 후각 망울에서 칼슘의 변경 사항을 모니터링을 통해 온도에 의한 신경 세포의 활동을 기록

생활 Xenopus Tadpoles에 후 각 통로의 기능 평가

Investigation of Activated Mouse Olfactory Sensory Neurons via Combined Immunostaining and in situ Hybridization