ويدعم هذا العمل رابطة تشجيع الابتكار للشباب CAS (2021084) وصندوق دعم مشروع النشر الرئيسي لخطة العمل الثلاثية لمعهد علم الأحياء الدقيقة ، الأكاديمية الصينية للعلوم.

1. تحضير نباتات N. benthamiana
<ol><li>ضع كتل الشتلات في صينية ، أضف 1 لتر من الماء وانقعه لمدة 2 ساعة تقريبا حتى يتشبع تماما.</li>
	<li>يرش بالتساوي بذور N. benthamiana من النوع البري على كتل الشتلات ، ويغطى بغطاء ، وينبت لمدة 1 أسبوع. تنمو N. benthamiana في دفيئة مع فترة ضوئية 18 ساعة ، 24 درجة مئوية ، 45 ٪ رطوبة نسبية ، وتخصيب كل أسبوعين.</li>
	<li>بمجرد أن تنبت البذور ، استخدم الملقط لإزالة الشتلات برفق ، مع الحرص على عدم التسبب في تلف جذورها. احفر حفرة صغيرة في وسط صينية جديدة ، ضع الشتلات فيها ، وقم بتغطية الجذور برفق بالتربة. مع تغطية غطاء والاستمرار في النمو.</li>
	<li>تنمو حتى الشتلات لديها ثلاث أوراق ، مع الغطاء. قم بإزالة الغطاء عندما تظهرالورقة الحقيقية 4 .</li>
	<li>اسمح للنباتات بالاستمرار في النمو لمدة أسبوعين آخرين قبل التسلل الزراعي.</li>
</ol>2. بناء GFP المؤتلف - HIS
<ol><li>إجراء تحسين كودون N. benthamiana وتوليف GFP و PR1a (MGFVLFSQLPSFLLVSTLLLFLVISHSCRAG) بناء على تسلسل الجينات.</li>
	<li>إجراء الهضم المزدوج لناقل pCAMBIA1300 باستخدام إنزيمات Xba I و Sac I (انظر جدول المواد).</li>
	<li>إجراء تضخيم PR1a باستخدام الاشعال المنبع (TTGGAGAGAACACGGGACTCTAGAATGGGATT TGTTCTCTTTTC) والبادئات النهائية (TCCTCG CCCTTGCTCACCATGTCACCCCCCGGCACGGCAAGA GTGGG) ، تضخيم GFP باستخدام الاشعال المنبع (CCCACTCTTGCCGTGCCGGGGGGCATGGTGAGTGAGTGAG CAAGGGCGAGGA) والبادئات النهائية (GGGGAAATTCGAGCTCGTGGTGGTGGTGGTG GTGAGATCTTCCGGACTTGT).</li>
	<li>باستخدام إعادة التركيب المتماثل ، استنساخ PR1a ، و GFP في ناقل التعبير النباتي pCAMBIA1300. بعد النقل إلى الإشريكية القولونية ، حدد استنساخا فرديا وأرسلها إلى الشركة للتسلسل. مقارنة نتائج التسلسل والبلازميد الأيمن هو البلازميد المؤتلف pCAMBIA1300-PR1a-GFP-His، المشار إليه باسم p35s-PR1a-GFP-His.</li>
</ol>3. إنتاج هيئة أجيال السلام في شمال بنثاميانا
<ol><li>أضف 1 ميكرولتر من بلازميد GFP إلى 50 ميكرولتر من خلايا مستقبلات Agrobacterium GV3101 ، واخلطها برفق وأضفها إلى كوب القطب ، ثم أزلها بعد الصعق بالكهرباء على الصعق الكهربائي.</li>
	<li>انتشار Agrobacterium tumefaciens المحولة على صفيحة متوسطة صلبة LB تحتوي على 50 ميكروغرام / مل كاناميسين (كان) و 50 ميكروغرام / مل ريفامبيسين (ريف). احتضان مقلوب عند 28 درجة مئوية لمدة 48 ساعة. ناقل pCAMBIA1300 مقاوم للكان ، و Agrobacterium مقاوم للريف. فقط Agrobacterium الصحيح يمكن أن تنمو على لوحات مع كان والريف. كانت المستنسخة وحيدة النسيلة هي المحولات الإيجابية ، المسماة A. tumefaciens GV3101-p35s-PR1a-GFP-His (AtGPG).</li>
	<li>استخدم عود أسنان معقم لالتقاط كمية مناسبة من AtGPG وتلقيحها في 4 مل من LB السائل مع Kan و Rif. الثقافة عند 28 درجة مئوية ، 220-300 دورة في الدقيقة لمدة 24 ساعة.</li>
	<li>بكتيريا الاستزراع الفرعي 1:50 إلى LB طازج (50 ميكروغرام / مل Kan ، 10 mM 2- (N-Morpholino) حمض إيثان سلفونيك (MES) ، 20 ميكرومتر أسيتوسيرينجون (AS)) وتحضن عند 28 درجة مئوية ، 220-300 دورة في الدقيقة لمدة 10-12 ساعة.</li>
	<li>حصاد البكتيريا عن طريق الطرد المركزي عند 1500 × جم لمدة 10 دقائق وإعادة تعليق الحبيبات ب 1 مل من MMA (10 mM MgCl2 ، 10 mM MES pH 5.6 ، 100 μM AS).</li>
	<li>قياس وضبط الكثافة البصرية (OD) من AtGPG إلى OD600 = 0.8 باستخدام MMA. احتضان البكتيريا لمدة 2-4 ساعات أخرى في درجة حرارة الغرفة. ارسم المحلول البكتيري باستخدام حقنة عديمة الإبر ، واضغط عليه على ظهر الأوراق برفق ، واضغط لاختراق المحلول في الأوراق. حقن فقط الأوراق الوسطى 3-4 لكل نبات.</li>
	<li>استمر في زراعة N. benthamiana في الدفيئة لمدة 3-4 أيام قبل حصاد الأوراق لاستخراج البروتين.</li>
</ol>4. مراقبة التوطين تحت الخلوي ل GFP
<ol><li>بعد 48 ساعة من التسلل الزراعي ، حدد ورقة مسطحة واستخدم ثقب 6 مم لربط الشفرة للتثقيب.</li>
	<li>قم بتقطير محلول السكروز بنسبة 30٪ على شريحة زجاجية ، ضع عينة الورقة بحيث يكون الظهر متجها لأعلى وقم بتغطيتها بغطاء زجاجي.</li>
	<li>اضبط الطول الموجي للإثارة على 488 نانومتر واكتشف التألق الأخضر عند 490-550 نانومتر بعد تكبير 400x. التقط الصورة الأولى بمجرد إعداد الشريحة وصورة أخرى بعد 10 دقائق.</li>
</ol>5. استخراج GFP من النبات
<ol><li>استخراج AWF<ol><li>اجمع أوراق N. benthamiana الطازجة السليمة التي تعبر عن GFP المؤتلف في 3 أيام بعد التسلل الزراعي. عالج الورقة برفق وحافظ على سلامة الأوراق لتجنب تدفق البروتين داخل الخلايا. استخدم الأوراق المجمعة للخطوة التالية على الفور لتجنب تدهور البروتين.</li>
		<li>اشطف شفرة الورقة ب ddH2O المعقم المبرد مسبقا لإزالة الحطام.</li>
		<li>قم بوزن الأوراق الطازجة واغمر 20 جم من الأوراق (الجانب المحوري لأسفل) في 100 مل من محلول فوسفات 100 مللي متر المبرد مسبقا (PB 100 mMNa 2HPO4 و 100 mM NaH2PO4 تم تكوينهما وخلطهما بشكل منفصل بنسبة 2.2: 1 درجة حموضة 7.0) في دورق واسع الفم سعة 200 مل. قم بتغطية الأوراق بخيوط شبكية دقيقة من النايلون 100 شبكي (انظر جدول المواد) ولوحة بلاستيكية. ملاحظة: التبريد المسبق يمنع تدهور البروتين. يمكن تعديل أحجام التخزين المؤقت بناء على المقياس التجريبي. تأكد من غمر جميع الأوراق.</li>
		<li>ضع الكأس الزجاجية في مضخة تفريغ. تطبيق فراغ 0.8 ميجا باسكال لمدة 1 دقيقة ، ثم استعادة بسرعة إلى الضغط الجوي.</li>
		<li>قم بإزالة الأوراق من المخزن المؤقت وجففها برفق بورق ماص. نشمر الأوراق ونلفها بخيوط شبكية ونضع 5 جم من الأوراق في كل أنبوب طرد مركزي سعة 50 مل. لجمع AWF ، يترك الأوراق الملفوفة في الموضع جانبا لأعلى في أنابيب مع خيوط شبكية مثبتة بواسطة أغطية الأنابيب.</li>
		<li>أجهزة الطرد المركزي عند 4 درجات مئوية ، 500 × جم لمدة 5 دقائق. قم بإزالة الأوراق وجمع AWF في الجزء السفلي من الأنبوب باستخدام ماصة. يمكن الحصول على حوالي 5 مل من AWF من كل أنبوب. ملاحظة: من أجل تقليل التداخل من البروتينات داخل الخلايا واستخراج أكبر قدر ممكن من بروتينات AWF ، يمكن تكرار الاستخراج 2x-3x ، ولكن ليس أكثر من 3x.</li>
	</ol></li>
	<li>استخراج البروتين الكلي القابل للذوبان<ol><li>طحن 20 غرام يترك في مسحوق ناعم في النيتروجين السائل. أضف محلول الاستخراج (50 mM Tris-HCl pH 7.4 ، 150 mM NaCl ، 10٪ جلسرين ، 1٪ Triton X-100 ، 0.034٪ β-mercaptoethanol (انظر جدول المواد)) بنسبة 1: 2.</li>
		<li>رج المزيج في خلاط عمودي لمدة 30 دقيقة عند 4 درجات مئوية. تجانس أجهزة الطرد المركزي عند 13000 × جم لمدة 15 دقيقة عند 4 درجات مئوية.</li>
		<li>انقل المادة الطافية إلى أنبوب جديد وكرر الطرد المركزي لمدة 15 دقيقة. نقل طافت تطهيرها إلى أنبوب آخر.</li>
		<li>قم بتصفية المادة الطافية من خلال مرشح 0.22 ميكرومتر (انظر جدول المواد) للحصول على مستخلص البروتين الكلي القابل للذوبان.</li>
	</ol></li>
</ol>  
6. تنقية GFP-His مع كروماتوغرافيا تقارب النيكل (Ni)
ملاحظة: نفذ جميع الخطوات عند 4 درجات مئوية.
<ol><li>أضف راتنج Ni sepharose excel (انظر جدول المواد) إلى أنبوب بنسبة 1: 1000 بالنسبة إلى حجم مستخلص البروتين من الخطوة 5.1.6. حجم الراتنج يساوي 1/1000عشر من حجم مستخلص البروتين.</li>
	<li>اغسل راتنج النيكل 3x بحجم راتنج 10x من ddH2O و PB (درجة الحموضة 7.0) بشكل منفصل بدوره وقم بإزالة المادة الطافية.</li>
	<li>احتضان مستخلص البروتين مع راتنج النيكل لمدة 2 ساعة للسماح بالربط الكامل. جهاز طرد مركزي عند 500 × جم لمدة 5 دقائق لإزالة البروتينات غير المنضمة في المادة الطافية. اغسل 3x بحجم راتنج 20x من PB. أجهزة الطرد المركزي في 500 × غرام لمدة 5 دقائق وإزالة طاف.</li>
	<li>Elute GFP-His عن طريق إضافة 10x حجم الراتنج من 250 mM إيميدازول (50 mM Tris-HCl pH 7.4 ، 150 mM كلوريد الصوديوم ، 10٪ الجلسرين ، 250 mM إيميدازول) وجمع المادة الطافية.</li>
</ol>7. تلطيخ كوماسي الأزرق للبروتينات
<ol><li>أضف 10 ميكرولتر من 5x SDS تحميل المخزن المؤقت إلى 40 ميكرولتر من عينات البروتين ، ثم غلي لمدة 10 دقائق ، ثم قم بتشغيله على 15٪ SDS-PAGE عند 110 فولت لمدة 60 دقيقة.</li>
	<li>جل بروتين البقع مع محلول Coomassie الأزرق (0.1٪ R-250 ، 25٪ أيزوبروبانول ، 10٪ حمض الخليك الجليدي) لمدة 2 ساعة.</li>
	<li>اسكب المحلول واغسله بمحلول إزالة اللون لمدة 2 ساعة. مراقبة الجل. سيتم تلوين البروتينات الموجودة على الجل باللون الأزرق.</li>
</ol>8. النشاف الغربي للبروتينات
<ol><li>أضف 10 ميكرولتر من 5x SDS تحميل المخزن المؤقت إلى 40 ميكرولتر من عينات البروتين ، ثم غلي لمدة 10 دقائق ، ثم قم بتشغيله على 15٪ SDS-PAGE عند 110 فولت لمدة 60 دقيقة.</li>
	<li>نقل البروتينات إلى غشاء نيتروسليلوز 0.45 ميكرومتر عند 280 مللي أمبير. سد الغشاء مع 5 ٪ الحليب منزوع الدسم لمدة 1 ساعة.</li>
	<li>تمييع الأجسام المضادة المضادة لعلامة His-tag في 1: 5000 واحتضان الغشاء مع الأجسام المضادة لمدة 1 ساعة. استخدم محلول ملحي مخزن تريس وتوين 20 (TBST) لغسل الغشاء 4x لمدة 5 دقائق.</li>
	<li>تمييع الأجسام المضادة للفأر في 1: 10000 واحتضان الغشاء مع الأجسام المضادة لمدة 1 ساعة. استخدم TBST لغسل الغشاء 4x لمدة 5 دقائق.</li>
	<li>امزج المطور (انظر جدول المواد) بنسبة 1: 1. أضف 400 ميكرولتر إلى الغشاء واتركه يتفاعل لمدة 1 دقيقة. التقط صورا بعد 1 دقيقة من التعرض باستخدام متخيل.</li>
</ol>9. مقايسة تركيز البروتين
<ol><li>أضف 5 ميكرولتر من البروتين إلى 1 مل من كاشف صبغة برادفورد 1x وتفاعل لمدة 5 دقائق.</li>
	<li>حدد قيمة OD595 بعد التصفير واحسب تركيز البروتين من المنحنى القياسي.</li>
</ol>10. تقدير كمية البروتين 31
<ol><li>أداء النشاف الغربي لعينات البروتين جنبا إلى جنب مع المعايير.</li>
	<li>إجراء تقدير كمي ل GFP حسب النسبة إلى المعايير باستخدام تحليل التدرج الرمادي ImageJ 1.5.0.</li>
</ol>

كفاءة استخراج وتنقية GFP-HIS من أوراق N. benthamiana

<ol>
	<li>Zahmanova, G., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Green+biologics:+Harnessing+the+power+of+plants+to+produce+pharmaceuticals.">Green biologics: Harnessing the power of plants to produce pharmaceuticals.</a> Int J Mol Sci. 24 (24), 1757 (2023).</li><li>PREVAIL Writing Group. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=A+randomized,+controlled+trial+of+ZMapp+for+Ebola+virus+infection.">A randomized, controlled trial of ZMapp for Ebola virus infection.</a> N Engl J Med. 375 (15), 1448-1456 (2016).</li><li>Ma, J. K. C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Regulatory+approval+and+a+first-in-human+phase+I+clinical+trial+of+a+monoclonal+antibody+produced+in+transgenic+tobacco+plants.">Regulatory approval and a first-in-human phase I clinical trial of a monoclonal antibody produced in transgenic tobacco plants.</a> Plant Biotechnol J. 13 (8), 1106-1120 (2015).</li><li>Shanmugaraj, B., Rattanapisit, K., Manopwisedjaroen, S., Thitithanyanont, A., Phoolcharoen, W. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Monoclonal+antibodies+B38+and+H4+produced+in+Nicotiana+benthamiana+neutralize+SARS-CoV-2+in+vitro.">Monoclonal antibodies B38 and H4 produced in Nicotiana benthamiana neutralize SARS-CoV-2 in vitro.</a> Front Plant Sci. 11, 589995 (2020).</li><li>Takeyama, N., Kiyono, H., Yuki, Y. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Plant-based+vaccines+for+animals+and+humans:+Recent+advances+in+technology+and+clinical+trials.">Plant-based vaccines for animals and humans: Recent advances in technology and clinical trials.</a> Ther Adv Vaccines. 3 (5-6), 139-154 (2015).</li><li>Ward, B. J., S&#233;guin, A., Couillard, J., Tr&#233;panier, S., Landry, N. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Phase+III:+Randomized+observer-blind+trial+to+evaluate+lot-to-lot+consistency+of+a+new+plant-derived+quadrivalent+virus+like+particle+influenza+vaccine+in+adults+18-49+years+of+age.">Phase III: Randomized observer-blind trial to evaluate lot-to-lot consistency of a new plant-derived quadrivalent virus like particle influenza vaccine in adults 18-49 years of age.</a> Vaccine. 39 (10), 1528-1533 (2021).</li><li>Siriwattananon, K., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Plant-produced+receptor-binding+domain+of+SARS-CoV-2+elicits+potent+neutralizing+responses+in+mice+and+non-human+primates.">Plant-produced receptor-binding domain of SARS-CoV-2 elicits potent neutralizing responses in mice and non-human primates.</a> Front Plant Sci. 12, 682953 (2021).</li><li>Leblanc, Z., Waterhouse, P., Bally, J. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Plant-based+vaccines:+The+way+ahead.">Plant-based vaccines: The way ahead.</a> Viruses. 13 (1), 5 (2020).</li><li>Sethi, L., Kumari, K., Dey, N. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Engineering+of+plants+for+efficient+production+of+therapeutics.">Engineering of plants for efficient production of therapeutics.</a> Mol Biotechnol. 63 (12), 1125-1137 (2021).</li><li>Webster, D. E., Thomas, M. C. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Post-translational+modification+of+plant-made+foreign+proteins;+glycosylation+and+beyond.">Post-translational modification of plant-made foreign proteins; glycosylation and beyond.</a> Biotechnol Adv. 30 (2), 410-418 (2012).</li><li>Streatfield, S. J. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Approaches+to+achieve+high-level+heterologous+protein+production+in+plants.">Approaches to achieve high-level heterologous protein production in plants.</a> Plant Biotechnol J. 5 (1), 2-15 (2007).</li><li>Nandi, S., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Process+development+and+economic+evaluation+of+recombinant+human+lactoferrin+expressed+in+rice+grain.">Process development and economic evaluation of recombinant human lactoferrin expressed in rice grain.</a> Transgenic Res. 14 (3), 237-249 (2005).</li><li>Ullrich, K. K., Hiss, M., Rensing, S. A. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Means+to+optimize+protein+expression+in+transgenic+plants.">Means to optimize protein expression in transgenic plants.</a> Curr Opin Biotechnol. 32, 61-67 (2015).</li><li>Su, H., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Plant-made+vaccines+against+viral+diseases+in+humans+and+farm+animals.">Plant-made vaccines against viral diseases in humans and farm animals.</a> Front Plant Sci. 14, 1170815 (2023).</li><li>Agrawal, G. K., Jwa, N. S., Lebrun, M. H., Job, D., Rakwal, R. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Plant+secretome:+Unlocking+secrets+of+the+secreted+proteins.">Plant secretome: Unlocking secrets of the secreted proteins.</a> Proteomics. 10 (4), 799-827 (2010).</li><li>Kim, T., Gondr&#233;-Lewis, M. C., Arnaoutova, I., Loh, Y. P. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Dense-core+secretory+granule+biogenesis.">Dense-core secretory granule biogenesis.</a> Physiology. 21, 124-133 (2006).</li><li>Menkhaus, T. J., Bai, Y., Zhang, C., Nikolov, Z. L., Glatz, C. E. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Considerations+for+the+recovery+of+recombinant+proteins+from+plants.">Considerations for the recovery of recombinant proteins from plants.</a> Biotechnol Prog. 20 (4), 1001-1014 (2004).</li><li>Kim, S. T., Cho, K. S., Jang, Y. S., Kang, K. Y. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Two-dimensional+electrophoretic+analysis+of+rice+proteins+by+polyethylene+glycol+fractionation+for+protein+arrays.">Two-dimensional electrophoretic analysis of rice proteins by polyethylene glycol fractionation for protein arrays.</a> Electrophoresis. 22 (10), 2103-2109 (2001).</li><li>Xi, J., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Polyethylene+glycol+fractionation+improved+detection+of+low-abundant+proteins+by+two-dimensional+electrophoresis+analysis+of+plant+proteome.">Polyethylene glycol fractionation improved detection of low-abundant proteins by two-dimensional electrophoresis analysis of plant proteome.</a> Phytochemistry. 67 (21), 2341-2348 (2006).</li><li>Dani, V., Simon, W. J., Duranti, M., Croy, R. R. D. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Changes+in+the+tobacco+leaf+apoplast+proteome+in+response+to+salt+stress.">Changes in the tobacco leaf apoplast proteome in response to salt stress.</a> Proteomics. 5 (3), 737-745 (2005).</li><li>Delaunois, B., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Uncovering+plant-pathogen+crosstalk+through+apoplastic+proteomic+studies.">Uncovering plant-pathogen crosstalk through apoplastic proteomic studies.</a> Front Plant Sci. 5, 249 (2014).</li><li>Andreasson, E., Abreha, K. B., Resj&#246;, S. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Isolation+of+apoplast.">Isolation of apoplast.</a> Methods Mol. Biol. 1511, 233-240 (2017).</li><li>Lohaus, G., Pennewiss, K., Sattelmacher, B., Hussmann, M., Hermann, M. K. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Is+the+infiltration-centrifugation+technique+appropriate+for+the+isolation+of+apoplastic+fluid?+A+critical+evaluation+with+different+plant+species.">Is the infiltration-centrifugation technique appropriate for the isolation of apoplastic fluid? A critical evaluation with different plant species.</a> Physiol Plant. 111 (4), 457-465 (2001).</li><li>Nouchi, I., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Overcoming+the+difficulties+in+collecting+apoplastic+fluid+from+rice+leaves+by+the+infiltration-centrifugation+method.">Overcoming the difficulties in collecting apoplastic fluid from rice leaves by the infiltration-centrifugation method.</a> Plant Cell Physiol. 53 (9), 1659-1668 (2012).</li><li>Rumyantseva, N. I., Valieva, A. I., Kostyukova, Y. A., Ageeva, M. V. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+effect+of+leaf+plasticity+on+the+isolation+of+apoplastic+fluid+from+leaves+of+tartary+buckwheat+plants+grown+in+vivo+and+in+vitro.">The effect of leaf plasticity on the isolation of apoplastic fluid from leaves of tartary buckwheat plants grown in vivo and in vitro.</a> Plants. 12 (23), 4048 (2023).</li><li>Ekanayake, G., Gohmann, R., Mackey, D. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=A+method+for+quantitation+of+apoplast+hydration+in+Arabidopsis+leaves+reveals+water-soaking+activity+of+effectors+of+Pseudomonas+syringae+during+biotrophy.">A method for quantitation of apoplast hydration in Arabidopsis leaves reveals water-soaking activity of effectors of Pseudomonas syringae during biotrophy.</a> Sci Rep. 12 (1), 18363 (2022).</li><li>Preston, G. M., Fones, H. N., Mccraw, S., Rico, A., O'leary, B. M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+infiltration-centrifugation+technique+for+extraction+of+apoplastic+fluid+from+plant+leaves+using+phaseolus+vulgaris+as+an+example.">The infiltration-centrifugation technique for extraction of apoplastic fluid from plant leaves using phaseolus vulgaris as an example.</a> J Vis Exp. (94), e52113 (2014).</li><li>Nandi, S., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Process+development+and+economic+evaluation+of+recombinant+human+lactoferrin+expressed+in+rice+grain.">Process development and economic evaluation of recombinant human lactoferrin expressed in rice grain.</a> Transgenic Res. 14 (3), 237-249 (2005).</li><li>Menkhaus, T. J., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Considerations+for+the+recovery+of+recombinant+proteins+from+plants.">Considerations for the recovery of recombinant proteins from plants.</a> Biotechnol Prog. 20 (4), 1001-1014 (2004).</li><li>Streatfield, S. J. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Approaches+to+achieve+high-level+heterologous+protein+production+in+plants.">Approaches to achieve high-level heterologous protein production in plants.</a> Plant Biotechnol J. 5 (1), 2-15 (2007).</li><li>Yamamoto, T., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Improvement+of+the+transient+expression+system+for+production+of+recombinant+proteins+in+plants.">Improvement of the transient expression system for production of recombinant proteins in plants.</a> Sci Rep. 8 (1), 4755 (2018).</li><li>Zhao, J., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Wheat+Apoplast-localized+lipid+transfer+protein+TaLTP3+enhances+defense+responses+against+Puccinia+triticina.">Wheat Apoplast-localized lipid transfer protein TaLTP3 enhances defense responses against Puccinia triticina.</a> Front Plant Sci. 12, 771806 (2021).</li><li>Venkataraman, S., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Recent+advances+in+expression+and+purification+strategies+for+plant+made+vaccines.">Recent advances in expression and purification strategies for plant made vaccines.</a> Front Plant Sci. 14, 1273958 (2023).</li><li>Witzel, K., Shahzad, M., Matros, A., Mock, H. P., M&#252;hling, K. H. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Comparative+evaluation+of+extraction+methods+for+apoplastic+proteins+from+maize+leaves.">Comparative evaluation of extraction methods for apoplastic proteins from maize leaves.</a> Plant Meth. 7, 48 (2011).</li></ol>

يعلن أصحاب البلاغ عدم وجود تضارب في المصالح.

توسع استخدام النباتات لإنتاج البروتينات العلاجية بسرعة في السنوات الأخيرة1،2،3،4،5،6. يتم استنساخ الجينات المشفرة للبروتين في ناقلات التعبير وتسليمها إلى أنسجة النبات عن طريق الار...

في الوقت الحاضر ، هناك العديد من البروتينات العلاجية المؤتلفة المنتجة في النباتات قيد الدراسة ، بما في ذلك الأجسام المضادة واللقاحات والبروتينات النشطة بيولوجيا والإنزيمات والببتيدات الصغيرة1،2،3،4،5،6. أصبحت النباتات منصة مستخدمة بشكل متزايد لإنتاج البروتينات العلاجية نظرا لسلامتها وتكلفتها المنخفضة وقدرتها على توسيع نطاق الإنتاج بسرعة 7,8. يعد التعبير عن البروتين وتعديله في الأنظمة النباتية ، إلى جانب تنقية البروتين ، من العوامل الحاسمة التي تحدد إنتاجية المفاعلات الحيوية النباتية 9,10. يعد تعزيز إنتاجية النبات والحصول على بروتينات مستهدفة عالية النقاء من التحديات الأساسية التي تواجه أنظمة الإنتاج النباتية11,12.
يعتمد توطين البروتينات تحت الخلوية وتعديلها على ببتيد الإشارة المحدد المشفر في N-terminus ، والذي يستهدف البروتين إلى وجهته العضية النهائية أثناء التعبير الجيني. تم تصميم البروتينات المؤتلفة للتوطين في apoplast أو الشبكة الإندوبلازمية (ER) أو البلاستيدات الخضراء أو الفجوة أو السيتوبلازم ، بناء على خصائصها الفريدة13. بالنسبة للمستضدات والأجسام المضادة ، يفضل البروتينات المفرزة. قبل الإفراز ، تتقدم البروتينات من خلال ER و Golgi للطي الصحيح والتعديلات اللاحقةللترجمة 14،15،16.
بعد الإنتاج في النباتات ، يجب تنقية البروتينات المؤتلفة من المستخلصات النباتية. عادة ، يتم تنقية البروتينات من المستخلصات النباتية الكلية القابلة للذوبان ، والتي تحتوي على بروتينات وفيرة داخل الخلايا ، ومنتجات غير مطوية وغير معدلة ، والسيتوكرومات17. لإزالة الشوائب ، تخضع المستخلصات النباتية لتجزئة واسعة النطاق ، بما في ذلك كروماتوغرافيا التقارب الخاصة بالريبولوز -1،5-ثنائي فوسفات الكربوكسيلاز / الأكسجين (RuBisCO) ، ترسيب الفيتات ، ترسيب البولي إيثيلين جلايكول ، وتعديل درجة الحرارة ودرجة الحموضة18,19. خطوات إزالة الشوائب هذه شاقة ويمكن أن تضر بجودة البروتين.
تعرف الحجرة الخلوية للنبات الواقعة خارج الغشاء البلازمي بأنها البلاستيدات الأبوبلية، وتشمل الجدار الخلوي، والفراغات بين الخلوية، ونسيجالخشب 20. يطلق على المرحلة المائية عادة اسم سائل غسيل apoplast (AWF). يحتوي AWF على جزيئات تفرزها الخلايا لتنظيم العديد من التطورات البيولوجية مثل النقل ، واستقلاب جدار الخلية ، واستجابات الإجهاد 21,22. على عكس TSP ، فإن المكونات الجزيئية ل AWF أقل تعقيدا. قد يؤدي استخراج البروتينات المؤتلفة من AWF إلى تجنب التلوث بالبروتينات داخل الخلايا والمنتجات غير المطوية والبقايا السيتوبلازمية. باختصار ، تدخل دهون الاستخراج الأوراق عبر الثغور تحت ضغط سلبي ، ويتم جمع AWF عن طريق الطرد المركزي اللطيف23. في حين يتم استخدام عزل AWF على نطاق واسع لدراسة التقدم البيولوجي داخل apoplast24،25،26،27 ، لم يتم استغلاله في أنظمة الإنتاج النباتية.
يعد تحسين إنتاجية النبات والحصول على بروتينات مستهدفة عالية النقاء من التحديات الرئيسية لأنظمة الإنتاج النباتي28. عادة ، يتم تنقية البروتينات من إجمالي المستخلصات النباتية القابلة للذوبان التي تحتوي على كميات كبيرة من البروتينات داخل الخلايا ، والمنتجات غير المطوية وغير المعدلة ، والسيتوكرومات29 ، والتي تتطلب تكاليف كبيرة للتنقية اللاحقة30. يمكن أن يؤدي استخدام طرق استخراج البروتين AWF لاستخراج البروتينات الخارجية المؤتلفة التي تفرز في apoplast إلى تحسين تجانس البروتينات المؤتلفة بشكل فعال وتقليل تكلفة تنقية البروتين. هنا ، نستخدم إشارة الببتيد PR1a لتمكين إفراز البروتين الخارجي في فضاء apoplast وإدخال طريقة مفصلة لتنقية البروتين المؤتلف من AWF من N. benthamiana.

<table border="1" fo:keep-together.within-page="1" fo:keep-with-next.within-page="always">
	<tbody>
		<tr>
			<td>100 mesh nylon fine mesh yarn</td>
			<td>Guangzhou Huayu Trading limited company</td>
			<td>hy-230724-2</td>
			<td>For AWF protein extraction</td>
		</tr>
		<tr>
			<td>50 ml centrifuge tubes</td>
			<td>Vazyme</td>
			<td>TCF00150</td>
			<td>For centrifuge</td>
		</tr>
		<tr>
			<td>ClonExpress II one step cloning kit</td>
			<td>Vazyme</td>
			<td>C112-02</td>
			<td>For clone</td>
		</tr>
		<tr>
			<td>FastDigest Sac1</td>
			<td>NEB</td>
			<td>R3156S</td>
			<td>For clone</td>
		</tr>
		<tr>
			<td>FastDigest XbaI</td>
			<td>NEB</td>
			<td>FD0685</td>
			<td>For clone</td>
		</tr>
		<tr>
			<td>ImageJ 1.5.0</td>
			<td>/</td>
			<td>/</td>
			<td>For greyscale analysis</td>
		</tr>
		<tr>
			<td>Large filter</td>
			<td>Thermo Fisher</td>
			<td>NEST</td>
			<td>For filtering</td>
		</tr>
		<tr>
			<td>Laser scanning confocal microscopy</td>
			<td>Leica SP8</td>
			<td></td>
			<td>For subcellular localization</td>
		</tr>
		<tr>
			<td>Ni sepharose excel</td>
			<td>Cytiva</td>
			<td>10339806</td>
			<td>For protein purification</td>
		</tr>
		<tr>
			<td>Precast protein plus gel</td>
			<td>YEASEN</td>
			<td>36246ES10</td>
			<td>For SDS-PAGE</td>
		</tr>
		<tr>
			<td>Small filter</td>
			<td>Nalgene</td>
			<td>1660045</td>
			<td>For filtering</td>
		</tr>
		<tr>
			<td>SuperSignal West Femto Substrate Trial Kit</td>
			<td>Thermo Fisher</td>
			<td>34076</td>
			<td>For western blotting</td>
		</tr>
		<tr>
			<td>Triton X-100</td>
			<td>SCR</td>
			<td>30188928</td>
			<td>To configure the extraction buffer</td>
		</tr>
		<tr>
			<td>Type rotaryvang vacuum pump</td>
			<td>Zhejiang taizhouqiujing vacuum pump limited company</td>
			<td>2XZ-2</td>
			<td>For vacuum infiltration</td>
		</tr>
		<tr>
			<td>Vertical mixer</td>
			<td>Haimen Qilinbel Instrument Manufacturing limited company</td>
			<td>BE-1200</td>
			<td>For mixing</td>
		</tr>
		<tr>
			<td>&#946;-mercaptoethanol</td>
			<td>SIGMA</td>
			<td>BCBK8223V</td>
			<td>To configure the extraction buffer</td>
		</tr>
	</tbody>
</table>

apoplast-extraction based method to improve the purity of plant produced recombinant protein  

النباتات هي نظام تعبير حقيقي النواة تم تطويره حديثا يتم استكشافه لإنتاج بروتينات علاجية. تعد تنقية البروتينات المؤتلفة من النباتات واحدة من أهم الخطوات في عملية الإنتاج. عادة ، تم تنقية البروتينات من البروتينات الكلية القابلة للذوبان (TSP) ، ويشكل وجود بروتينات متنوعة داخل الخلايا والسيتوكرومات تحديات لخطوات تنقية البروتين اللاحقة. علاوة على ذلك ، يتم إفراز معظم البروتينات العلاجية مثل المستضدات والأجسام المضادة للحصول على الجليكوزيل المناسب ، ويؤدي وجود البروتينات المعدلة بشكل غير كامل إلى عدم اتساق هياكل المستضد أو الأجسام المضادة. يقدم هذا العمل طريقة أكثر فعالية للحصول على بروتينات مؤتلفة عالية النقاء من الفضاء اللدائن للنبات. تم تصميم البروتين الفلوري الأخضر المؤتلف (GFP) ليتم إفرازه في منطقة نيكوتيانا بينثاميانا ثم يتم استخراجه باستخدام طريقة الطرد المركزي للتسلل. ثم يتم تنقية GFP-His من apoplast المستخرج بواسطة كروماتوغرافيا تقارب النيكل. على عكس الطرق التقليدية من TSP ، ينتج التنقية من apoplast بروتينات مؤتلفة عالية النقاء. وهذا يمثل تحسنا تكنولوجيا هاما لنظم الإنتاج النباتي.

Nowadays, various plant-produced recombinant therapeutic proteins are under study, including antibodies, vaccines, bioactive proteins, enzymes, and small polypeptides1,2,3,4,5,6. Plants are becoming an increasingly utilized platform for producing therapeutic proteins due to their safety, low cost, and ability to rapidly scale production7,8. Protein expression and modification in plant systems, along with protein purification, are critical factors determining the productivity of plant bioreactors9,10. Enhancing plant productivity and obtaining high-purity target proteins are core challenges facing plant-based production systems11,12.
The subcellular localization and modification of recombinant proteins depends on the specific signal peptide encoded at the N-terminus, which targets the protein to its final organelle destination during gene expression. Recombinant proteins are designed to localize to the apoplast, endoplasmic reticulum (ER), chloroplast, vacuole, or cytoplasm, based on their unique properties13. For antigens and antibodies, secreted proteins are preferred. Before secretion, proteins progress through ER and Golgi for correct folding and post-translational modifications14,15,16.
After production in plants, recombinant proteins must be purified from plant extracts. Typically, proteins are purified from total soluble plant extracts, which contain abundant intracellular proteins, misfolded and unmodified products, and cytochromes17. To remove impurities, plant extracts undergo extensive fractionation, including ribulose-1,5-bisphosphate carboxylase/oxygenase (RuBisCO)-specific affinity chromatography, phytate precipitation, polyethylene glycol precipitation, and adjustment of temperature and pH18,19. Such impurity-removal steps are laborious and can compromise protein quality.
The plant cell compartment beyond the plasma membrane is defined as the apoplast, encompassing the cell wall, intercellular spaces, and xylem20. The aqueous phase is commonly called apoplast washing fluid (AWF). AWF contains molecules secreted by cells to regulate numerous biological progresses like transport, cell wall metabolism, and stress responses21,22. In contrast to TSP, the molecular constituents of AWF are less complex. Extracting recombinant proteins from AWF may avoid contamination by intracellular proteins, misfolded products, and cytoplasmic remnants. Briefly, extraction lipid enters leaves through the stomata under negative pressure, and the AWF is collected by gentle centrifugation23. While isolation of AWF is widely employed to study the biological progress inside apoplast24,25,26,27, it has not been exploited in plant-based production systems.
Improving plant productivity and obtaining high purity target proteins are central challenges for plant production systems28. Typically, proteins are purified from total soluble plant extracts containing large amounts of intracellular proteins, misfolded and unmodified products, and cytochromes29, which require great costs for subsequent purification30. The use of AWF protein extraction methods for the extraction of exogenous recombinant proteins secreted into apoplast can effectively improve the homogeneity of recombinant proteins and reduce the cost of protein purification. Here, we use a signal peptide PR1a to enable exogenous protein secretion into the apoplast space and introduce a detailed method for recombinant protein purification from the AWF of N. benthamiana.

تسليط الضوء على المؤلف: تحسين استخراج بروتين أبوبلاست من أجل الاسترداد الفعال للبروتينات المؤتلفة من الخلايا النباتية

طريقة قائمة على استخراج أبوبلاست لتحسين نقاء البروتين المؤتلف المنتج من النبات  

We investigated how to extract recombinant proteins from plant cells more efficiently. We answered the question of whether the apoplast protein extraction method is feasible when applied to the recombinant proteins. This extraction method extracts proteins secreted into the apoplast, so they have homogeneity.There is no need for cell disruption, which reduce the interference from intracellular proteins and the subsequent purification costs. We will focus on how to increase the secretion of recombinant proteins in the apoplast space to further improve the efficiency of the apoplast protein extraction method.

يستهدف GFP-His للإفراز في الفضاء الأوسلجي ل N. benthamiana تم استنساخ GFP في بلازميد pCAMBIA1300 مع ببتيد إشارة PR1a N-terminal للإفراز وعلامة His-terminal C للتنقية ، مما يولد p35s-PR1a-GFP-HIS (الشكل 1 أ). تم التعبير عن البروتين المؤتلف بشكل عابر في N. benthamiana وتم الكشف عن نطاق 30 كيلو ...

عادة ما تواجه البروتينات النباتية تحديا في تنقية البروتينات المؤتلفة من الأنظمة النباتية. يوفر هذا العمل طريقة لاستخراج وتنقية البروتين المؤتلف المفرز بشكل فعال من أبوبلاست نيكوتيانا بينثاميانا.

Plants are a newly developing eukaryotic expression system being explored to produce therapeutic proteins. Purification of recombinant proteins from ...

apoplast-extraction-based-method-to-improve-purity-plant-produced

Research

JoVE Journal

Biology

Apoplast-Extraction Based Method to Improve the Purity of Plant Produced Recombinant Protein  

672 Views.  Shandong First Medical University. بحثنا في كيفية استخراج البروتينات المؤتلفة من الخلايا النباتية بشكل أكثر كفاءة. أجبنا عن السؤال حول ما إذا كانت طريقة استخلاص بروتين أبوبلاست ممكنة عند تطبيقها على البروتينات المعاد الاتحاد. تستخرج طريقة الاستخلاص هذه البروتينات التي تفرز في الأبوبلاس?...

Video: تسليط الضوء على المؤلف: تحسين استخراج بروتين أبوبلاست من أجل الاسترداد الفعال للبروتينات المؤتلفة من الخلايا النباتية

Plants are a newly developing eukaryotic expression system being explored to produce therapeutic proteins. Purification of recombinant proteins from plants is one of the most critical steps in the production process. Typically, proteins were purified from total soluble proteins (TSP), and the presence of miscellaneous intracellular proteins and cytochromes poses challenges for subsequent protein purification steps. Moreover, most therapeutic proteins like antigens and antibodies are secreted to obtain proper glycosylation, and the presence of incompletely modified proteins leads to inconsistent antigen or antibody structures. This work introduces a more effective method to obtain highly purified recombinant proteins from the plant apoplastic space. The recombinant Green fluorescent protein (GFP) is engineered to be secreted into the apoplast of Nicotiana benthamiana and is then extracted using an infiltration-centrifugation method. The GFP-His from the extracted apoplast is then purified by nickel affinity chromatography. In contrast to the traditional methods from TSP, purification from the apoplast produces highly purified recombinant proteins. This represents an important technological improvement for plant production systems.

The purification of recombinant proteins from plant systems is usually challenged by plant proteins. This work provides a method to effectively extract and purify a secreted recombinant protein from the apoplast of Nicotiana benthamiana.

Extraction and Purification of a Secreted Recombinant Protein from the Apoplast of Nicotiana benthamiana

To observe subcellular localization of GFP, after 48 hours of agroinfiltration of Nicotiana benthamiana, select a flat leaf and make a six-millimeter hole using a hole punch. Drip 30%sucrose solution onto a glass slide. Place the leaf sample with the back facing upwards, and cover it with a cover glass.Collect the intact, fresh N.benthamiana leaves expressing recombinant GFP at three days post-agroinfiltration, and weigh the leaves. Rinse the leaf blade with pre-cooled, sterilized, double-distilled water to remove debris. Submerge 20 grams with the abaxial side down in 500 milliliters of pre-cooled 100-millimolar phosphate buffer in a 1, 000 milliliter wide-mouth beaker.Cover the leaves with 100 mesh nylon, fine mesh yarn and a plastic plate. Connect the beaker to a vacuum pump. Apply 0.8 megapascal vacuum for one minute, then quickly restore to atmospheric pressure.Remove leaves from the buffer and gently blot dry with absorbent paper. Roll up the leaves and wrap them with mesh yarn. For collecting apoplastic washing fluid, or AWF, position rolled leaves tip-side up in 50-milliliter centrifuge tubes with mesh yarn fastened by the tube caps.Centrifuge the leaves at 500g for five minutes at four degrees Celsius. Remove the leaves and collect AWF using a pipette. Add Nickel Sepharose excel resin to a tube in a one-to-1, 000 ratio relative to the protein extract volume.Wash nickel resin three times with 10 times the resin volume of double-distilled water and phosphate buffer separately, in turn. Incubate protein extract with nickel resin for two hours to allow full binding. Then, centrifuge at 500g for five minutes at four degrees Celsius to remove unbound proteins in the supernatant.Wash three times with 20 times the resin volume of phosphate buffer. After the last wash, add 10 times the resin volume of 250 millimolar imidazole to elute GFPs. Centrifuge the mixture at 500g for five minutes at four degrees Celsius, and collect the supernatant.Western blot analysis confirmed the transient expression of 30 kilodalton recombinant protein GFPs in N.benthamiana. Fluorescence microscopy illustrated the presence of GFPs within the apoplast. AWF proteins extracted by vacuum infiltration centrifugation also contained GFPs.Out of the eight extraction solutions tested, phosphate buffer extracted the greatest amount of AWF and GFPs. Comparing phosphate buffer at varying pH revealed improved AWF and GFPs extraction at neutral to mildly alkaline conditions. Additionally, 100 millimolar phosphate buffer showed maximal efficacy for recovering AWF and GFPs.With a 100-millimolar phosphate buffer, 495 micrograms of total AWF proteins per gram of fresh leaf were recovered from the apoplast. The extracted AWF contained 10 micrograms of GFPs, which corresponded to approximately 18%of the GFPs in the total soluble protein. Following nickel affinity chromatography, GFPs'purity reached 84.3%from AWF extraction, substantially higher than the 44.9%purity achieved through total soluble protein extraction.