이 작업은 2021084(Youth Innovation Promotion Association CAS)와 중국과학원(Chinese Academy of Sciences) 미생물학 연구소(Institute of Microbiology, Chinese Academy of Sciences)의 3개년 실행 계획(Three-Year Action Plan)의 핵심 배치 프로젝트 지원 기금(Key Deployment Project Support Fund)의 지원을 받습니다.

1. N. benthamiana 식물의 준비
<ol><li>묘목 블록을 트레이에 넣고 물 1L를 넣고 완전히 포화 될 때까지 약 2 시간 동안 담가 둡니다.</li>
	<li>묘목 블록에 야생형 N. benthamiana 씨앗을 골고루 뿌리고 뚜껑을 덮고 1주일 동안 발아시킵니다. N. benthamiana 는 18시간 광주기, 24°C, 45% 상대 습도의 온실에서 키우고 2주마다 비료를 줍니다.</li>
	<li>씨앗이 싹을 틔우면 핀셋을 사용하여 뿌리에 손상을 주지 않도록 주의하면서 묘목을 부드럽게 제거합니다. 새 쟁반 중앙에 작은 구덩이를 파고 묘목을 그 안에 넣고 뿌리를 흙으로 가볍게 덮습니다. 뚜껑을 덮고 계속 자랍니다.</li>
	<li>모종에 뚜껑을 덮고 세 개의 잎이 나올 때까지 자랍니다. 4번째 참 잎이 나오면 뚜껑을 제거하십시오.</li>
	<li>식물이 그로인침습 전에 2주 더 자라도록 하십시오.</li>
</ol>2. 재조합형 GFP-His의 구축
<ol><li>유전자 염기서열을 기반으로 GFP 및 PR1a(MGFVLFSQLPSFLLVSTLLLFLVISHSCRAG)의 N. benthamiana 코돈 최적화 및 합성을 수행합니다.</li>
	<li>Xba I 및 Sac I 효소를 사용하여 pCAMBIA1300 벡터의 이중 분해를 수행합니다( 재료 표 참조).</li>
	<li>업스트림 프라이머(TTGGAGAGAACACGGGGGACTCTAGAATGGGATT)를 사용하여 PR1a의 증폭을 수행합니다. TGTTCTCTTTTC) 및 다운스트림 프라이머(TCCTCG CCCTTGCTCACCATGTCGACCCCGGCACGGCAAGA GTGGG), 업스트림 프라이머를 사용한 GFP 증폭(CCCACTCTTGCCGTGCCGGGGTCGACATGGTGAG CAAGGGCGAGGA) 및 다운스트림 프라이머(GGGGAAATTCGAGCTCTCAGTGGTGATGGTG GTGAGATCTTCCGGACTTGT)입니다.</li>
	<li>상동 재조합을 사용하여 PR1a 및 GFP를 pCAMBIA1300 식물 발현 벡터로 복제합니다. 대장균으로 이식한 후 단일 클론을 선택하여 회사로 보내 염기서열분석을 실시합니다. 염기서열분석 결과와 올바른 플라스미드를 비교하면 p35s-PR1a-GFP-His라고 하는 재조합 플라스미드 pCAMBIA1300-PR1a-GFP-His가 있습니다.</li>
</ol>3. N. benthamiana에 있는 GFP-His의 생산
<ol><li>50 μL의 아그로박테리움 수용체 세포 GV3101에 GFP 플라스미드 1 μL를 첨가하고, 부드럽게 섞어 전극 컵에 첨가하고, 전기충격기에 감전사 후 제거합니다.</li>
	<li>50 μg/mL 카나마이신(Kan) 및 50 μg/mL 리팜피신(Rif)을 함유한 LB 고체 중간 플레이트에 형질전환된 Agrobacterium tumefaciens 를 펴 바릅니다. 28 °C에서 48 시간 동안 뒤집어 배양합니다. pCAMBIA1300 벡터는 kan-resistant이고 Agrobacterium은 rif-resistant입니다. 올바른 Agrobacterium 만이 kan과 rif가있는 접시에서 자랄 수 있습니다. 단클론 클론은 A. tumefaciens GV3101-p35s-PR1a-GFP-His (AtGPG)로 명명된 양성 형질전환체였다.</li>
	<li>멸균된 이쑤시개를 사용하여 적당량의 AtGPG를 집어 Kan 및 Rif와 함께 4mL의 액체 LB에 접종합니다. 28 °C, 220-300 rpm에서 24 시간 동안 배양</li>
	<li>하위 배양 박테리아 1:50을 신선한 LB(50μg/mL Kan, 10mM 2-(N-Morpholino) 에탄술폰산(MES), 20μM 아세토시링곤(AS))에 넣고 28°C, 220-300rpm에서 10-12시간 동안 배양합니다.</li>
	<li>1500 x g 에서 10분 동안 원심분리하여 박테리아를 수확하고 펠릿에 1mL의 MMA(10mM MgCl2, 10mM MES pH 5.6, 100μM AS)로 재현탁시킵니다.</li>
	<li>MMA를 사용하여 AtGPG의 광학 밀도(OD)를 OD600=0.8로 측정하고 조정합니다. 실온에서 2-4시간 더 박테리아를 배양합니다. 바늘이 없는 주사기로 세균 용액을 끌어올려 잎 뒤쪽에 가볍게 대고 압력을 가하여 용액이 잎 안으로 침투하도록 합니다. 식물 당 중간 3-4 개의 잎 만 주입하십시오.</li>
	<li>단백질 추출을 위해 잎을 수확하기 전에 온실에서 3-4일 동안 N. benthamiana 를 계속 성장시킵니다.</li>
</ol>4. GFP의 subcellular 국소화 관찰
<ol><li>48시간의 사포 침투 후 평평한 잎을 선택하고 6mm 구멍 펀치를 사용하여 clamp 펀칭을 위해 블레이드를 고정합니다.</li>
	<li>30% 자당 용액을 유리 슬라이드에 떨어뜨리고 뒷면이 위를 향하도록 잎 샘플을 놓고 커버 유리로 덮습니다.</li>
	<li>여기 파장을 488nm로 설정하고 400x 배율 후 490-550nm에서 녹색 형광을 감지합니다. 슬라이드가 준비되면 첫 번째 사진을 찍고 10분 후에 다른 사진을 찍습니다.</li>
</ol>5. 식물에서 GFP 추출
<ol><li>AWF 추출<ol><li>그로인침습 후 3일에 재조합 GFP를 발현하는 온전한 신선한 N. benthamiana 잎을 수집합니다. 잎을 부드럽게 다루고 잎을 온전하게 유지하여 세포 내 단백질 유출을 방지하십시오. 단백질 분해를 피하기 위해 수집된 잎을 즉시 다음 단계에 사용하십시오.</li>
		<li>잎 잎을 사전 냉각된 멸균 ddH2O로 헹구어 이물질을 제거합니다.</li>
		<li>신선한 잎의 무게를 측정하고 200mL의 입이 넓은 비커에 100mL의 사전 냉각된 100mM 인산염 완충액(PB 100mM Na2HPO4 및 100 mM NaH2PO4 를 별도로 구성하고 2.2:1 pH 7.0의 비율로 혼합)에 20g의 잎(축면이 아래로)에 담그십시오. 100 메쉬 나일론, 가는 메쉬 실( 재료 표 참조)과 플라스틱 판으로 잎을 덮습니다. 참고: 사전 냉각은 단백질 분해를 방지합니다. 버퍼 부피는 실험 규모에 따라 조정할 수 있습니다. 모든 잎이 잠겼는지 확인하십시오.</li>
		<li>비커를 진공 펌프에 넣습니다. 1분 동안 0.8MPa 진공을 적용한 다음 빠르게 대기압으로 복원합니다.</li>
		<li>완충액에서 잎을 제거하고 흡수성 종이로 부드럽게 물기를 닦아냅니다. 잎을 말아서 메쉬 실로 감싼 다음 각 50mL 원심분리기 튜브에 잎 5g을 넣습니다. AWF를 수집하려면 튜브 캡으로 고정된 메쉬 실을 사용하여 롤링된 잎을 튜브에 끝부분이 위로 향하게 놓습니다.</li>
		<li>4 °C, 500 x g 에서 5분 동안 원심분리기 잎을 제거하고 피펫을 사용하여 튜브 바닥의 AWF를 수집합니다. 각 튜브에서 약 5mL의 AWF를 얻을 수 있습니다. 참고: 세포 내 단백질의 간섭을 최소화하고 최대한의 AWF 단백질을 추출하기 위해 추출은 2x-3x를 반복할 수 있지만 3배 이상은 할 수 없습니다.</li>
	</ol></li>
	<li>총 용해성 단백질 추출<ol><li>잎 20g을 액체 질소에 고운 가루로 갈아줍니다. 추출 완충액 (50 mM Tris-HCl pH 7.4, 150 mM NaCl, 10 % 글리세롤, 1 % Triton X-100, 0.034 % β- 메르 캅토 에탄올 ( 재료 표 참조))을 1 : 2 비율로 첨가하십시오.</li>
		<li>수직 믹서에서 4 ° C에서 30 분 동안 균질하게 흔듭니다. 원심분리기는 13,000 x g 에서 4°C에서 15분 동안 균질화합니다.</li>
		<li>상층액을 새 튜브로 옮기고 15분 동안 원심분리를 반복합니다. 세척된 상층액을 다른 튜브로 옮깁니다.</li>
		<li>0.22μm 필터( 재료 표 참조)를 통해 상층액을 여과하여 총 용해성 단백질 추출물을 얻습니다.</li>
	</ol></li>
</ol>  
6. 니켈(Ni) 친화성 크로마토그래피를 사용한 GFP-His 정제
알림: 4 °C에서 모든 단계를 수행하십시오.
<ol><li>Ni sepharose excel 수지( 재료 표 참조)를 5.1.6단계의 단백질 추출물 부피를 기준으로 1:1000 비율로 튜브에 추가합니다. 수지 부피는 단백질 추출물부피의 1 /1000과 같습니다.</li>
	<li>Ni 수지를 ddH, 2, O, PB(pH 7.0)의 10배 수지 부피로 차례로 3배 세척하고 상층액을 제거합니다.</li>
	<li>단백질 추출물을 Ni 수지와 함께 2시간 동안 배양하여 완전히 결합할 수 있도록 합니다. 500 x g 에서 5분 동안 원심분리하여 상층액에서 결합되지 않은 단백질을 제거합니다. 20x 용량의 PB 수지로 3회 세척합니다. 500 x g 에서 5분 동안 원심분리하고 상층액을 제거합니다.</li>
	<li>250 mM 이미 다졸 (50 mM Tris-HCl pH 7.4, 150 mM NaCl, 10 % 글리세롤, 250 mM 이미 다졸)의 10x 수지 부피를 첨가하여 GFP-His를 용출하고 상층액을 수집합니다.</li>
</ol>7. 단백질의 Coomassie 청색 염색
<ol><li>단백질 샘플 40 μL에 10 μL의 5x SDS 로딩 버퍼를 추가하고 10 분 동안 끓인 다음 110 V의 15 % SDS-PAGE에서 60 분 동안 실행합니다.</li>
	<li>Coomassie blue 용액 (0.1 % R-250, 25 % 이소프로판올, 10 % 빙초산)을 2 시간 동안 염색 단백질 젤.</li>
	<li>용액을 붓고 탈색 용액으로 2시간 동안 세척합니다. 젤을 관찰하십시오. 겔의 단백질은 파란색으로 착색됩니다.</li>
</ol>8. 단백질의 서부 blotting
<ol><li>단백질 샘플 40 μL에 10 μL의 5x SDS 로딩 버퍼를 추가하고 10 분 동안 끓인 다음 110 V의 15 % SDS-PAGE에서 60 분 동안 실행합니다.</li>
	<li>280mA에서 0.45μm 니트로셀룰로오스 막으로 단백질을 전달합니다. 5% 탈지유로 1시간 동안 멤브레인을 차단합니다.</li>
	<li>anti-His-tag 항체를 1:5000으로 희석하고 항체가 있는 멤브레인을 1시간 동안 배양합니다. 트리스 완충 식염수와 트윈 20(TBST)을 사용하여 멤브레인을 4분 동안 5번 세척합니다.</li>
	<li>항-마우스 항체를 1:10000으로 희석하고 항체가 있는 멤브레인을 1시간 동안 배양합니다. TBST를 사용하여 멤브레인을 4분 동안 5번 세척합니다.</li>
	<li>현상액( 재료 표 참조)을 1:1의 비율로 혼합합니다. 멤브레인에 400μL를 추가하고 1분 동안 반응시킵니다. 비주얼라이저로 1분 노출 후 사진을 찍습니다.</li>
</ol>9. 단백질 농도 분석
<ol><li>Bradford 1x 염료 시약 1mL에 단백질 5μL를 넣고 5분 동안 반응합니다.</li>
	<li>영점 조정 후 OD595 값을 결정하고 표준 곡선에서 단백질 농도를 계산합니다.</li>
</ol>10. 단백질 정량 31
<ol><li>표준물질과 함께 단백질 샘플의 웨스턴 블로팅(Western blotting)을 수행합니다.</li>
	<li>ImageJ 1.5.0 그레이스케일 분석을 사용하여 표준물질에 대한 비율로 GFP를 정량화합니다.</li>
</ol>

N. benthamiana 잎에서 GFP-His의 효율적인 추출 및 정제

<ol>
	<li>Zahmanova, G., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Green+biologics:+Harnessing+the+power+of+plants+to+produce+pharmaceuticals.">Green biologics: Harnessing the power of plants to produce pharmaceuticals.</a> Int J Mol Sci. 24 (24), 1757 (2023).</li><li>PREVAIL Writing Group. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=A+randomized,+controlled+trial+of+ZMapp+for+Ebola+virus+infection.">A randomized, controlled trial of ZMapp for Ebola virus infection.</a> N Engl J Med. 375 (15), 1448-1456 (2016).</li><li>Ma, J. K. C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Regulatory+approval+and+a+first-in-human+phase+I+clinical+trial+of+a+monoclonal+antibody+produced+in+transgenic+tobacco+plants.">Regulatory approval and a first-in-human phase I clinical trial of a monoclonal antibody produced in transgenic tobacco plants.</a> Plant Biotechnol J. 13 (8), 1106-1120 (2015).</li><li>Shanmugaraj, B., Rattanapisit, K., Manopwisedjaroen, S., Thitithanyanont, A., Phoolcharoen, W. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Monoclonal+antibodies+B38+and+H4+produced+in+Nicotiana+benthamiana+neutralize+SARS-CoV-2+in+vitro.">Monoclonal antibodies B38 and H4 produced in Nicotiana benthamiana neutralize SARS-CoV-2 in vitro.</a> Front Plant Sci. 11, 589995 (2020).</li><li>Takeyama, N., Kiyono, H., Yuki, Y. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Plant-based+vaccines+for+animals+and+humans:+Recent+advances+in+technology+and+clinical+trials.">Plant-based vaccines for animals and humans: Recent advances in technology and clinical trials.</a> Ther Adv Vaccines. 3 (5-6), 139-154 (2015).</li><li>Ward, B. J., S&#233;guin, A., Couillard, J., Tr&#233;panier, S., Landry, N. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Phase+III:+Randomized+observer-blind+trial+to+evaluate+lot-to-lot+consistency+of+a+new+plant-derived+quadrivalent+virus+like+particle+influenza+vaccine+in+adults+18-49+years+of+age.">Phase III: Randomized observer-blind trial to evaluate lot-to-lot consistency of a new plant-derived quadrivalent virus like particle influenza vaccine in adults 18-49 years of age.</a> Vaccine. 39 (10), 1528-1533 (2021).</li><li>Siriwattananon, K., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Plant-produced+receptor-binding+domain+of+SARS-CoV-2+elicits+potent+neutralizing+responses+in+mice+and+non-human+primates.">Plant-produced receptor-binding domain of SARS-CoV-2 elicits potent neutralizing responses in mice and non-human primates.</a> Front Plant Sci. 12, 682953 (2021).</li><li>Leblanc, Z., Waterhouse, P., Bally, J. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Plant-based+vaccines:+The+way+ahead.">Plant-based vaccines: The way ahead.</a> Viruses. 13 (1), 5 (2020).</li><li>Sethi, L., Kumari, K., Dey, N. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Engineering+of+plants+for+efficient+production+of+therapeutics.">Engineering of plants for efficient production of therapeutics.</a> Mol Biotechnol. 63 (12), 1125-1137 (2021).</li><li>Webster, D. E., Thomas, M. C. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Post-translational+modification+of+plant-made+foreign+proteins;+glycosylation+and+beyond.">Post-translational modification of plant-made foreign proteins; glycosylation and beyond.</a> Biotechnol Adv. 30 (2), 410-418 (2012).</li><li>Streatfield, S. J. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Approaches+to+achieve+high-level+heterologous+protein+production+in+plants.">Approaches to achieve high-level heterologous protein production in plants.</a> Plant Biotechnol J. 5 (1), 2-15 (2007).</li><li>Nandi, S., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Process+development+and+economic+evaluation+of+recombinant+human+lactoferrin+expressed+in+rice+grain.">Process development and economic evaluation of recombinant human lactoferrin expressed in rice grain.</a> Transgenic Res. 14 (3), 237-249 (2005).</li><li>Ullrich, K. K., Hiss, M., Rensing, S. A. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Means+to+optimize+protein+expression+in+transgenic+plants.">Means to optimize protein expression in transgenic plants.</a> Curr Opin Biotechnol. 32, 61-67 (2015).</li><li>Su, H., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Plant-made+vaccines+against+viral+diseases+in+humans+and+farm+animals.">Plant-made vaccines against viral diseases in humans and farm animals.</a> Front Plant Sci. 14, 1170815 (2023).</li><li>Agrawal, G. K., Jwa, N. S., Lebrun, M. H., Job, D., Rakwal, R. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Plant+secretome:+Unlocking+secrets+of+the+secreted+proteins.">Plant secretome: Unlocking secrets of the secreted proteins.</a> Proteomics. 10 (4), 799-827 (2010).</li><li>Kim, T., Gondr&#233;-Lewis, M. C., Arnaoutova, I., Loh, Y. P. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Dense-core+secretory+granule+biogenesis.">Dense-core secretory granule biogenesis.</a> Physiology. 21, 124-133 (2006).</li><li>Menkhaus, T. J., Bai, Y., Zhang, C., Nikolov, Z. L., Glatz, C. E. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Considerations+for+the+recovery+of+recombinant+proteins+from+plants.">Considerations for the recovery of recombinant proteins from plants.</a> Biotechnol Prog. 20 (4), 1001-1014 (2004).</li><li>Kim, S. T., Cho, K. S., Jang, Y. S., Kang, K. Y. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Two-dimensional+electrophoretic+analysis+of+rice+proteins+by+polyethylene+glycol+fractionation+for+protein+arrays.">Two-dimensional electrophoretic analysis of rice proteins by polyethylene glycol fractionation for protein arrays.</a> Electrophoresis. 22 (10), 2103-2109 (2001).</li><li>Xi, J., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Polyethylene+glycol+fractionation+improved+detection+of+low-abundant+proteins+by+two-dimensional+electrophoresis+analysis+of+plant+proteome.">Polyethylene glycol fractionation improved detection of low-abundant proteins by two-dimensional electrophoresis analysis of plant proteome.</a> Phytochemistry. 67 (21), 2341-2348 (2006).</li><li>Dani, V., Simon, W. J., Duranti, M., Croy, R. R. D. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Changes+in+the+tobacco+leaf+apoplast+proteome+in+response+to+salt+stress.">Changes in the tobacco leaf apoplast proteome in response to salt stress.</a> Proteomics. 5 (3), 737-745 (2005).</li><li>Delaunois, B., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Uncovering+plant-pathogen+crosstalk+through+apoplastic+proteomic+studies.">Uncovering plant-pathogen crosstalk through apoplastic proteomic studies.</a> Front Plant Sci. 5, 249 (2014).</li><li>Andreasson, E., Abreha, K. B., Resj&#246;, S. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Isolation+of+apoplast.">Isolation of apoplast.</a> Methods Mol. Biol. 1511, 233-240 (2017).</li><li>Lohaus, G., Pennewiss, K., Sattelmacher, B., Hussmann, M., Hermann, M. K. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Is+the+infiltration-centrifugation+technique+appropriate+for+the+isolation+of+apoplastic+fluid?+A+critical+evaluation+with+different+plant+species.">Is the infiltration-centrifugation technique appropriate for the isolation of apoplastic fluid? A critical evaluation with different plant species.</a> Physiol Plant. 111 (4), 457-465 (2001).</li><li>Nouchi, I., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Overcoming+the+difficulties+in+collecting+apoplastic+fluid+from+rice+leaves+by+the+infiltration-centrifugation+method.">Overcoming the difficulties in collecting apoplastic fluid from rice leaves by the infiltration-centrifugation method.</a> Plant Cell Physiol. 53 (9), 1659-1668 (2012).</li><li>Rumyantseva, N. I., Valieva, A. I., Kostyukova, Y. A., Ageeva, M. V. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+effect+of+leaf+plasticity+on+the+isolation+of+apoplastic+fluid+from+leaves+of+tartary+buckwheat+plants+grown+in+vivo+and+in+vitro.">The effect of leaf plasticity on the isolation of apoplastic fluid from leaves of tartary buckwheat plants grown in vivo and in vitro.</a> Plants. 12 (23), 4048 (2023).</li><li>Ekanayake, G., Gohmann, R., Mackey, D. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=A+method+for+quantitation+of+apoplast+hydration+in+Arabidopsis+leaves+reveals+water-soaking+activity+of+effectors+of+Pseudomonas+syringae+during+biotrophy.">A method for quantitation of apoplast hydration in Arabidopsis leaves reveals water-soaking activity of effectors of Pseudomonas syringae during biotrophy.</a> Sci Rep. 12 (1), 18363 (2022).</li><li>Preston, G. M., Fones, H. N., Mccraw, S., Rico, A., O'leary, B. M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+infiltration-centrifugation+technique+for+extraction+of+apoplastic+fluid+from+plant+leaves+using+phaseolus+vulgaris+as+an+example.">The infiltration-centrifugation technique for extraction of apoplastic fluid from plant leaves using phaseolus vulgaris as an example.</a> J Vis Exp. (94), e52113 (2014).</li><li>Nandi, S., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Process+development+and+economic+evaluation+of+recombinant+human+lactoferrin+expressed+in+rice+grain.">Process development and economic evaluation of recombinant human lactoferrin expressed in rice grain.</a> Transgenic Res. 14 (3), 237-249 (2005).</li><li>Menkhaus, T. J., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Considerations+for+the+recovery+of+recombinant+proteins+from+plants.">Considerations for the recovery of recombinant proteins from plants.</a> Biotechnol Prog. 20 (4), 1001-1014 (2004).</li><li>Streatfield, S. J. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Approaches+to+achieve+high-level+heterologous+protein+production+in+plants.">Approaches to achieve high-level heterologous protein production in plants.</a> Plant Biotechnol J. 5 (1), 2-15 (2007).</li><li>Yamamoto, T., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Improvement+of+the+transient+expression+system+for+production+of+recombinant+proteins+in+plants.">Improvement of the transient expression system for production of recombinant proteins in plants.</a> Sci Rep. 8 (1), 4755 (2018).</li><li>Zhao, J., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Wheat+Apoplast-localized+lipid+transfer+protein+TaLTP3+enhances+defense+responses+against+Puccinia+triticina.">Wheat Apoplast-localized lipid transfer protein TaLTP3 enhances defense responses against Puccinia triticina.</a> Front Plant Sci. 12, 771806 (2021).</li><li>Venkataraman, S., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Recent+advances+in+expression+and+purification+strategies+for+plant+made+vaccines.">Recent advances in expression and purification strategies for plant made vaccines.</a> Front Plant Sci. 14, 1273958 (2023).</li><li>Witzel, K., Shahzad, M., Matros, A., Mock, H. P., M&#252;hling, K. H. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Comparative+evaluation+of+extraction+methods+for+apoplastic+proteins+from+maize+leaves.">Comparative evaluation of extraction methods for apoplastic proteins from maize leaves.</a> Plant Meth. 7, 48 (2011).</li></ol>

저자는 이해 상충이 없음을 선언합니다.

식물을 사용하여 치료용 단백질을 생산하는 것은 최근 몇 년 동안 빠르게 확장되었습니다 1,2,3,4,5,6. 단백질을 암호화하는 유전자는 발현 벡터로 클로닝되어 아그로인filtration을 통해 식물 조직으로 전달됩니다. 식물 세포에 의한 생산 후, 단백질은 ...

요즘에는 항체, 백신, 생체 활성 단백질, 효소 및 작은 폴리펩티드 1,2,3,4,5,6을 포함한 다양한 식물 생산 재조합 치료 단백질이 연구되고 있습니다. 식물은 안전성, 저렴한 비용 및 생산을 빠르게 확장할 수 있는 능력으로 인해 치료용 단백질을 생산하기 위해 점점 더 많이 활용되는 플랫폼이 되고 있습니다 7,8. 단백질 정제와 함께 식물 시스템의 단백질 발현 및 변형은 식물 생물반응기 9,10의 생산성을 결정하는 중요한 요소입니다. 식물 생산성을 높이고 고순도 표적 단백질을 얻는 것은 식물 기반 생산 시스템이 직면한 핵심 과제입니다11,12.
재조합 단백질의 세포 내 국소화 및 변형은 유전자 발현 중 단백질을 최종 세포 기관 목적지까지 표적으로 하는 N-말단에서 인코딩된 특정 신호 펩타이드에 따라 달라집니다. 재조합 단백질은 고유한 특성을 기반으로 아포플라스트(apoplast), 소포체(endoplasmic reticulum, ER), 엽록체(chloroplast), 액포(vacuole) 또는 세포질(cytoplasm)에 국한되도록 설계되었다13. 항원과 항체의 경우 분비된 단백질이 선호됩니다. 분비하기 전에 단백질은 ER과 Golgi를 통해 올바른 접힘 및 번역 후 변형을 진행합니다 14,15,16.
식물에서 생산한 후에는 식물 추출물에서 재조합 단백질을 정제해야 합니다. 전형적으로, 단백질은 풍부한 세포내 단백질, 잘못 접히거나 변형되지 않은 산물 및 시토크롬을 함유하는 총 용해성 식물 추출물로부터 정제된다17. 불순물을 제거하기 위해 식물 추출물은 리불로스-1,5-비스포스페이트 카르복실라아제/산소화효소(RuBisCO) 특이적 친화성 크로마토그래피, 피트테이트 침전, 폴리에틸렌 글리콜 침전, 온도 및 pH18,19 조정을 포함한 광범위한 분획을 거칩니다. 이러한 불순물 제거 단계는 번거로우며 단백질 품질을 저하시킬 수 있습니다.
원형질막 너머의 식물 세포 구획은 세포벽, 세포 간 공간 및 물관(xylem 20)을 포함하는 아포플라스트(apoplast)로 정의됩니다. 수성상은 일반적으로 아포플라스트 세척액(AWF)이라고 합니다. AWF에는 수송, 세포벽 대사 및 스트레스 반응과 같은 수많은 생물학적 진행을 조절하기 위해 세포에서 분비되는 분자가 포함되어 있습니다 21,22. TSP와 달리 AWF의 분자 구성 요소는 덜 복잡합니다. AWF에서 재조합 단백질을 추출하면 세포 내 단백질, 잘못 접힌 산물 및 세포질 잔류물에 의한 오염을 방지할 수 있습니다. 간단히 말해서, 추출 지질은 음압 하에서 기공을 통해 잎으로 들어가고, AWF는 부드러운 원심분리23에 의해 수집된다. AWF의 분리는 apoplast24,25,26,27 내부의 생물학적 진행 상황을 연구하기 위해 널리 사용되지만 식물 기반 생산 시스템에서는 활용되지 않았습니다.
식물 생산성을 개선하고 고순도 표적 단백질을 얻는 것은 식물 생산 시스템의 핵심 과제입니다28. 전형적으로, 단백질은 다량의 세포내 단백질, 잘못 접히고 변형되지 않은 산물, 및 시토크롬(cytochrome)29을 함유하는 전용해성 식물 추출물로부터 정제되며, 이는 후속 정제를 위해 많은 비용을 필요로 한다(30). 아포플라스트로 분비되는 외인성 재조합 단백질의 추출을 위해 AWF 단백질 추출 방법을 사용하면 재조합 단백질의 균질성을 효과적으로 개선하고 단백질 정제 비용을 절감할 수 있습니다. 여기에서는 신호 펩타이드 PR1a를 사용하여 외인성 단백질이 아포플라스트 공간으로 분비될 수 있도록 하고, N. benthamiana의 AWF에서 재조합 단백질 정제를 위한 자세한 방법을 소개합니다.

<table border="1" fo:keep-together.within-page="1" fo:keep-with-next.within-page="always">
	<tbody>
		<tr>
			<td>100 mesh nylon fine mesh yarn</td>
			<td>Guangzhou Huayu Trading limited company</td>
			<td>hy-230724-2</td>
			<td>For AWF protein extraction</td>
		</tr>
		<tr>
			<td>50 ml centrifuge tubes</td>
			<td>Vazyme</td>
			<td>TCF00150</td>
			<td>For centrifuge</td>
		</tr>
		<tr>
			<td>ClonExpress II one step cloning kit</td>
			<td>Vazyme</td>
			<td>C112-02</td>
			<td>For clone</td>
		</tr>
		<tr>
			<td>FastDigest Sac1</td>
			<td>NEB</td>
			<td>R3156S</td>
			<td>For clone</td>
		</tr>
		<tr>
			<td>FastDigest XbaI</td>
			<td>NEB</td>
			<td>FD0685</td>
			<td>For clone</td>
		</tr>
		<tr>
			<td>ImageJ 1.5.0</td>
			<td>/</td>
			<td>/</td>
			<td>For greyscale analysis</td>
		</tr>
		<tr>
			<td>Large filter</td>
			<td>Thermo Fisher</td>
			<td>NEST</td>
			<td>For filtering</td>
		</tr>
		<tr>
			<td>Laser scanning confocal microscopy</td>
			<td>Leica SP8</td>
			<td></td>
			<td>For subcellular localization</td>
		</tr>
		<tr>
			<td>Ni sepharose excel</td>
			<td>Cytiva</td>
			<td>10339806</td>
			<td>For protein purification</td>
		</tr>
		<tr>
			<td>Precast protein plus gel</td>
			<td>YEASEN</td>
			<td>36246ES10</td>
			<td>For SDS-PAGE</td>
		</tr>
		<tr>
			<td>Small filter</td>
			<td>Nalgene</td>
			<td>1660045</td>
			<td>For filtering</td>
		</tr>
		<tr>
			<td>SuperSignal West Femto Substrate Trial Kit</td>
			<td>Thermo Fisher</td>
			<td>34076</td>
			<td>For western blotting</td>
		</tr>
		<tr>
			<td>Triton X-100</td>
			<td>SCR</td>
			<td>30188928</td>
			<td>To configure the extraction buffer</td>
		</tr>
		<tr>
			<td>Type rotaryvang vacuum pump</td>
			<td>Zhejiang taizhouqiujing vacuum pump limited company</td>
			<td>2XZ-2</td>
			<td>For vacuum infiltration</td>
		</tr>
		<tr>
			<td>Vertical mixer</td>
			<td>Haimen Qilinbel Instrument Manufacturing limited company</td>
			<td>BE-1200</td>
			<td>For mixing</td>
		</tr>
		<tr>
			<td>&#946;-mercaptoethanol</td>
			<td>SIGMA</td>
			<td>BCBK8223V</td>
			<td>To configure the extraction buffer</td>
		</tr>
	</tbody>
</table>

apoplast-extraction based method to improve the purity of plant produced recombinant protein  

식물은 치료용 단백질을 생산하기 위해 연구되고 있는 새롭게 개발된 진핵생물 발현 시스템입니다. 식물에서 재조합 단백질을 정제하는 것은 생산 공정에서 가장 중요한 단계 중 하나입니다. 일반적으로 단백질은 총 용해성 단백질(TSP)에서 정제되었으며, 기타 세포 내 단백질 및 사이토크롬의 존재는 후속 단백질 정제 단계에서 문제를 제기합니다. 또한, 항원 및 항체와 같은 대부분의 치료용 단백질은 적절한 당화(glycosylation)를 얻기 위해 분비되며, 불완전하게 변형된 단백질의 존재는 일관성 없는 항원 또는 항체 구조로 이어집니다. 이 연구는 식물 아포가소성 공간에서 고도로 정제된 재조합 단백질을 얻는 보다 효과적인 방법을 소개합니다. 재조합 Green 형광 단백질(GFP)은 Nicotiana benthamiana 의 아포플라스트로 분비되도록 설계한 다음 침투 원심분리 방법을 사용하여 추출합니다. 추출된 아포플라스트로부터의 GFP-His는 그런 다음 니켈 친화성 크로마토그래피로 정제됩니다. TSP의 기존 방법과 달리 아포플라스트에서 정제하면 고도로 정제된 재조합 단백질이 생성됩니다. 이는 플랜트 생산 시스템의 중요한 기술적 개선을 의미합니다.

Nowadays, various plant-produced recombinant therapeutic proteins are under study, including antibodies, vaccines, bioactive proteins, enzymes, and small polypeptides1,2,3,4,5,6. Plants are becoming an increasingly utilized platform for producing therapeutic proteins due to their safety, low cost, and ability to rapidly scale production7,8. Protein expression and modification in plant systems, along with protein purification, are critical factors determining the productivity of plant bioreactors9,10. Enhancing plant productivity and obtaining high-purity target proteins are core challenges facing plant-based production systems11,12.
The subcellular localization and modification of recombinant proteins depends on the specific signal peptide encoded at the N-terminus, which targets the protein to its final organelle destination during gene expression. Recombinant proteins are designed to localize to the apoplast, endoplasmic reticulum (ER), chloroplast, vacuole, or cytoplasm, based on their unique properties13. For antigens and antibodies, secreted proteins are preferred. Before secretion, proteins progress through ER and Golgi for correct folding and post-translational modifications14,15,16.
After production in plants, recombinant proteins must be purified from plant extracts. Typically, proteins are purified from total soluble plant extracts, which contain abundant intracellular proteins, misfolded and unmodified products, and cytochromes17. To remove impurities, plant extracts undergo extensive fractionation, including ribulose-1,5-bisphosphate carboxylase/oxygenase (RuBisCO)-specific affinity chromatography, phytate precipitation, polyethylene glycol precipitation, and adjustment of temperature and pH18,19. Such impurity-removal steps are laborious and can compromise protein quality.
The plant cell compartment beyond the plasma membrane is defined as the apoplast, encompassing the cell wall, intercellular spaces, and xylem20. The aqueous phase is commonly called apoplast washing fluid (AWF). AWF contains molecules secreted by cells to regulate numerous biological progresses like transport, cell wall metabolism, and stress responses21,22. In contrast to TSP, the molecular constituents of AWF are less complex. Extracting recombinant proteins from AWF may avoid contamination by intracellular proteins, misfolded products, and cytoplasmic remnants. Briefly, extraction lipid enters leaves through the stomata under negative pressure, and the AWF is collected by gentle centrifugation23. While isolation of AWF is widely employed to study the biological progress inside apoplast24,25,26,27, it has not been exploited in plant-based production systems.
Improving plant productivity and obtaining high purity target proteins are central challenges for plant production systems28. Typically, proteins are purified from total soluble plant extracts containing large amounts of intracellular proteins, misfolded and unmodified products, and cytochromes29, which require great costs for subsequent purification30. The use of AWF protein extraction methods for the extraction of exogenous recombinant proteins secreted into apoplast can effectively improve the homogeneity of recombinant proteins and reduce the cost of protein purification. Here, we use a signal peptide PR1a to enable exogenous protein secretion into the apoplast space and introduce a detailed method for recombinant protein purification from the AWF of N. benthamiana.

저자 스포트라이트: 식물 세포에서 재조합 단백질의 효율적인 회수를 위한 Apoplast 단백질 추출 최적화

식물에서 생산된 재조합 단백질의 순도를 향상시키기 위한 Apoplast-extraction 기반 방법  

We investigated how to extract recombinant proteins from plant cells more efficiently. We answered the question of whether the apoplast protein extraction method is feasible when applied to the recombinant proteins. This extraction method extracts proteins secreted into the apoplast, so they have homogeneity.There is no need for cell disruption, which reduce the interference from intracellular proteins and the subsequent purification costs. We will focus on how to increase the secretion of recombinant proteins in the apoplast space to further improve the efficiency of the apoplast protein extraction method.

GFP-His는 N. benthamiana의 아포플라스틱 공간으로의 분비를 목표로 합니다 GFP는 분비를 위한 N-말단 PR1a 신호 펩타이드와 정제를 위한 C-말단 His-태그를 사용하여 pCAMBIA1300 플라스미드에 클로닝하여 p35s-PR1a-GFP-His를 생성했습니다(그림 1A). 재조합 단백질은 N. benthamiana에서 일시적으로 발현되었으며 아그로인 여과 후 3일 후에 anti-His 항체를 ...

식물 시스템에서 재조합 단백질을 정제하는 것은 일반적으로 식물 단백질에 의해 도전됩니다. 이 연구는 니코티아나 벤타미아나(Nicotiana benthamiana)의 아포플라스트(apoplast)에서 분비된 재조합 단백질을 효과적으로 추출하고 정제하는 방법을 제공합니다.

Plants are a newly developing eukaryotic expression system being explored to produce therapeutic proteins. Purification of recombinant proteins from ...

apoplast-extraction-based-method-to-improve-purity-plant-produced

Research

JoVE Journal

Biology

Apoplast-Extraction Based Method to Improve the Purity of Plant Produced Recombinant Protein  

652 조회수.  Shandong First Medical University. 식물 세포에서 재조합 단백질을 보다 효율적으로 추출하는 방법을 조사했습니다. 우리는 apoplast 단백질 추출 방법이 재조합 단백질에 적용될 때 실현 가능한지에 대한 질문에 답했습니다. 이 추출법은 아포플라스트로 분비되는 단백질을 추출하여 균질성을 갖습니다.세포 파괴가 필요하지 않으므로 세포 내 단백질의 간섭과 그에 따른 정제 비?...