Diese Arbeit wird unterstützt von der Youth Innovation Promotion Association CAS (2021084) und dem Key Deployment Project Support Fund des Dreijahresaktionsplans des Instituts für Mikrobiologie der Chinesischen Akademie der Wissenschaften.

1. Vorbereitung der Pflanzen von N. benthamiana 
<ol><li>Legen Sie die Sämlingsblöcke in eine Schale, fügen Sie 1 l Wasser hinzu und weichen Sie sie ca. 2 h lang ein, bis sie vollständig gesättigt sind.</li>
	<li>Streuen Sie die Wildtyp-Samen von N. benthamiana gleichmäßig auf die Sämlingsblöcke, bedecken Sie sie mit einem Deckel und keimen Sie 1 Woche lang. Anbauen Sie N. benthamiana in einem Gewächshaus mit 18 h Photoperiode, 24 °C, 45% relativer Luftfeuchtigkeit und düngen Sie alle 2 Wochen.</li>
	<li>Sobald die Samen gekeimt sind, entferne den Sämling vorsichtig mit einer Pinzette und achte darauf, dass seine Wurzeln nicht beschädigt werden. Grabe eine kleine Grube in der Mitte einer neuen Schale, setze den Sämling hinein und bedecke die Wurzeln leicht mit Erde. Mit einem Deckel abdecken und weiter wachsen.</li>
	<li>Wachsen Sie, bis die Sämlinge drei Blätter haben, mit geschlossenem Deckel. Nehmen Sie den Deckel ab, wenn das 4. wahre Blatt herauskommt.</li>
	<li>Lassen Sie die Pflanzen noch zwei Wochen weiterwachsen, bevor Sie die Agroinfiltration fortsetzen.</li>
</ol>2. Aufbau des rekombinanten GFP-His
<ol><li>Durchführung der N . benthamiana-Codon-Optimierung und Synthese von GFP und PR1a (MGFVLFSQLPSFLLVSTLLLLLFLVISHSCRAG) basierend auf den Gensequenzen.</li>
	<li>Führen Sie einen doppelten Aufschluss des pCAMBIA1300-Vektors mit den Enzymen Xba I und Sac I durch (siehe Materialtabelle).</li>
	<li>Durchführung der Amplifikation von PR1a unter Verwendung von Upstream-Primern (TTGGAGAGAACGGGGGACTCTAGAATGGGATT TGTTCTCTTTTC) und nachgeschaltete Primer (TCCTCG CCCTTGCTCACCATGTCGACCCCGGCACGGCAAGA GTGGG), Amplifikation von GFP unter Verwendung von Upstream-Primern (CCCACTCTTGCCGTGCCGGGGTCGACATGGTGAG CAAGGGCGAGGA) und nachgeschaltete Primer (GGGGAAATTCGAGCTCTCAGTGGTGATGGTGGTG GTGAGATCTTCCGGACTTGT).</li>
	<li>Unter Verwendung der homologen Rekombination klonieren PR1a und GFP in den pflanzlichen Expressionsvektor pCAMBIA1300. Nach der Übertragung in E. coli wählen Sie einzelne Klone aus und senden Sie sie zur Sequenzierung an das Unternehmen. Vergleich der Sequenzierungsergebnisse und des richtigen Plasmids ist das rekombinante Plasmid pCAMBIA1300-PR1a-GFP-His, das als p35s-PR1a-GFP-His bezeichnet wird.</li>
</ol>3. Produktion von GFP-His in N. benthamiana
<ol><li>1 μl GFP-Plasmid in 50 μl Agrobacterium-Rezeptorzellen GV3101 geben, vorsichtig mischen und in den Elektrodenbecher geben, nach Stromschlag am Elektroschocker entfernen.</li>
	<li>Verteilen Sie transformiertes Agrobacterium tumefaciens auf eine LB-Platte mit festem Medium mit 50 μg/ml Kanamycin (Kan) und 50 μg/ml Rifampicin (Rif). Invertiert bei 28 °C 48 h inkubieren. Der Vektor pCAMBIA1300 ist kan-resistent und Agrobacterium ist rif-resistent; Nur das richtige Agrobacterium kann auf Platten mit kan und rif wachsen. Bei den monoklonalen Klonen handelte es sich um positive Transformanten mit dem Namen A. tumefaciens GV3101-p35s-PR1a-GFP-His (AtGPG).</li>
	<li>Verwenden Sie einen sterilisierten Zahnstocher, um eine angemessene Menge AtGPG aufzunehmen und es mit Kan und Rif in 4 ml flüssiges LB zu impfen. Kultur bei 28 °C, 220-300 U/min für 24 h.</li>
	<li>Subkulturieren Sie Bakterien 1:50 in frisches LB (50 μg/mL Kan, 10 mM 2-(N-Morpholino) Ethansulfonsäure (MES), 20 μM Acetosyringon (AS)) und inkubieren bei 28 °C, 220-300 U/min für 10-12 h.</li>
	<li>Ernten Sie die Bakterien durch Zentrifugation bei 1500 x g für 10 min und resuspendieren Sie das Pellet mit 1 mL MMA (10 mM MgCl2, 10 mM MES pH 5,6, 100 μM AS).</li>
	<li>Messen und justieren Sie die optische Dichte (OD) von AtGPG aufOD 600=0,8 mit MMA. Inkubieren Sie die Bakterien für weitere 2-4 Stunden bei Raumtemperatur. Ziehen Sie die Bakterienlösung mit einer nadellosen Spritze auf, drücken Sie sie leicht gegen die Rückseite der Blätter und üben Sie Druck aus, um die Lösung in die Blätter einzudringen. Injizieren Sie nur die mittleren 3-4 Blätter pro Pflanze.</li>
	<li>Bauen Sie N. benthamiana 3-4 Tage lang im Gewächshaus an, bevor Sie die Blätter für die Proteinextraktion ernten.</li>
</ol>4. Beobachtung der subzellulären Lokalisation von GFP
<ol><li>Nach 48 h Agroinfiltration wählen Sie ein flaches Blatt und verwenden Sie einen 6 mm Locher, um die Klinge zum Stanzen einzuspannen.</li>
	<li>30%ige Saccharoselösung auf einen Objektträger träufeln, die Blattprobe mit der Rückseite nach oben platzieren und mit einem Deckglas abdecken.</li>
	<li>Stellen Sie die Anregungswellenlänge auf 488 nm ein und detektieren Sie die grüne Fluoreszenz bei 490-550 nm nach 400-facher Vergrößerung. Machen Sie das erste Foto, sobald die Folie vorbereitet ist, und ein weiteres 10 Minuten später.</li>
</ol>5. Extraktion von GFP aus der Pflanze
<ol><li>AWF-Extraktion<ol><li>Sammeln Sie die intakten frischen Blätter von N. benthamiana , die 3 Tage nach der Agroinfiltration rekombinantes GFP exprimieren. Behandeln Sie das Blatt schonend und bewahren Sie die Integrität des Blattes, um einen intrazellulären Proteinausfluss zu vermeiden. Verwenden Sie gesammelte Blätter sofort für den nächsten Schritt, um einen Proteinabbau zu vermeiden.</li>
		<li>Spülen Sie die Blattklinge mit vorgekühltem, sterilisiertem ddH2O ab, um Schmutz zu entfernen.</li>
		<li>Frische Blätter werden gewogen und 20 g Blätter (mit der abaxialen Seite nach unten) in 100 mL vorgekühlten 100 mM Phosphatpuffer (PB 100 mM Na2, HPO4 und 100 mM NaH2PO4 wurden separat konfiguriert und in einem Verhältnis von 2,2:1 und pH 7,0 gemischt) in ein 200 mL Weithalsbecherglas getaucht. Die Blätter mit 100er feinem Nylongarn (siehe Materialtabelle) und einer Kunststoffplatte abdecken. HINWEIS: Die Vorkühlung verhindert den Proteinabbau. Die Puffervolumina können basierend auf der experimentellen Skala angepasst werden. Stellen Sie sicher, dass alle Blätter eingetaucht sind.</li>
		<li>Setzen Sie das Becherglas in eine Vakuumpumpe ein. Wenden Sie 1 Minute lang ein Vakuum von 0,8 MPa an und stellen Sie es dann schnell wieder auf Atmosphärendruck her.</li>
		<li>Entfernen Sie die Blätter aus dem Puffer und tupfen Sie sie vorsichtig mit saugfähigem Papier trocken. Die Blätter aufrollen, mit Netzgarn umwickeln und 5 g Blätter in jedes 50-ml-Zentrifugenröhrchen geben. Um AWF zu sammeln, legen Sie die gerollten Blätter mit der Spitze nach oben in Röhren mit Netzgarn, das an den Röhrenkappen befestigt ist.</li>
		<li>Zentrifugieren Sie bei 4 °C, 500 x g für 5 min. Entfernen Sie die Blätter und sammeln Sie das AWF mit einer Pipette am Boden des Röhrchens. Aus jedem Röhrchen können etwa 5 mL AWF gewonnen werden. HINWEIS: Um die Interferenz durch intrazelluläre Proteine zu minimieren und die maximale Menge an AWF-Proteinen zu extrahieren, kann die Extraktion 2x-3x, aber nicht mehr als 3x wiederholt werden.</li>
	</ol></li>
	<li>Extraktion des gesamten löslichen Proteins<ol><li>20 g Blätter in flüssigem Stickstoff zu feinem Pulver mahlen. Geben Sie Extraktionspuffer (50 mM Tris-HCl pH 7,4, 150 mM NaCl, 10 % Glycerin, 1 % Triton X-100, 0,034 % β-Mercaptoethanol (siehe Materialtabelle)) im Verhältnis 1: 2 zu.</li>
		<li>Das Homogenat in einem vertikalen Mischer 30 Minuten lang bei 4 °C schütteln. Zentrifugieren Sie das Homogenat bei 13.000 x g für 15 min bei 4 °C.</li>
		<li>Den Überstand in ein neues Röhrchen umfüllen und die Zentrifugation 15 Minuten wiederholen. Den gereinigten Überstand in ein anderes Röhrchen umfüllen.</li>
		<li>Filtrieren Sie den Überstand durch einen 0,22-μm-Filter (siehe Materialtabelle), um den gesamten löslichen Proteinextrakt zu erhalten.</li>
	</ol></li>
</ol>  
6. Reinigung von GFP-His mit Nickel (Ni)-Affinitätschromatographie
HINWEIS: Führen Sie alle Schritte bei 4 °C durch.
<ol><li>Geben Sie Ni-Sepharose-Excel-Harz (siehe Materialtabelle) in einem Verhältnis von 1:1000 in ein Röhrchen relativ zum Proteinextraktvolumen aus Schritt 5.1.6. Das Harzvolumen entspricht 1/1000des Volumens des Proteinextrakts.</li>
	<li>Ni-Harz 3x mit 10x Harzvolumen von ddH2O und PB (pH 7,0) nacheinander getrennt waschen und den Überstand entfernen.</li>
	<li>Inkubieren Sie den Proteinextrakt 2 Stunden lang mit Ni-Harz, um eine vollständige Bindung zu ermöglichen. Bei 500 x g für 5 min zentrifugieren, um ungebundene Proteine im Überstand zu entfernen. 3x mit 20x Harz Volumen PB waschen. Bei 500 x g 5 min zentrifugieren und den Überstand entfernen.</li>
	<li>Eluieren Sie GFP-His durch Zugabe von 10x Harzvolumen von 250 mM Imidazol (50 mM Tris-HCl pH 7,4, 150 mM NaCl, 10% Glycerin, 250 mM Imidazol) und sammeln Sie den Überstand.</li>
</ol>7. Coomassie-Blau-Färbung von Proteinen
<ol><li>10 μl 5x SDS-Ladepuffer zu 40 μl Proteinproben geben, 10 min kochen lassen, dann 60 min lang mit 15 % SDS-PAGE bei 110 V laufen lassen.</li>
	<li>Färben Sie Proteingele mit Coomassieblau-Lösung (0,1 % R-250, 25 % Isopropanol, 10 % Eisessig) für 2 h.</li>
	<li>Gießen Sie die Lösung ab und waschen Sie sie 2 h lang mit Entfärbungslösung. Beobachten Sie das Gel; Proteine auf dem Gel werden blau gefärbt.</li>
</ol>8. Western Blotting von Proteinen
<ol><li>10 μl 5x SDS-Ladepuffer zu 40 μl Proteinproben geben, 10 min kochen lassen, dann 60 min lang mit 15 % SDS-PAGE bei 110 V laufen lassen.</li>
	<li>Übertragen Sie Proteine auf eine 0,45 μm große Nitrozellulosemembran bei 280 mA. Blockieren Sie die Membran 1 h lang mit 5 % Magermilch.</li>
	<li>Verdünnen Sie die Anti-His-Tag-Antikörper bei 1:5000 und inkubieren Sie die Membran mit den Antikörpern 1 h lang. Mit der Tris-gepufferten Kochsalzlösung und dem Tween 20 (TBST) die Membran 4x für 5 min waschen.</li>
	<li>Verdünnen Sie die Anti-Maus-Antikörper bei 1:10000 und inkubieren Sie die Membran mit den Antikörpern 1 h lang. Waschen Sie die Membran mit TBST 4x für 5 min.</li>
	<li>Den Entwickler (siehe Materialtabelle) im Verhältnis 1:1 mischen. 400 μl auf die Membran geben und 1 min reagieren lassen. Machen Sie Fotos nach 1 Minute Belichtung mit einem Visualizer.</li>
</ol>9. Proteinkonzentrations-Assay
<ol><li>Geben Sie 5 μl Protein zu 1 ml Bradford 1x Farbstoffreagenz und reagieren Sie 5 Minuten lang.</li>
	<li>Bestimmen Sie den OD595-Wert nach dem Nullstellen und berechnen Sie die Proteinkonzentration aus der Normkurve.</li>
</ol>10. Quantifizierung von Proteinen 31
<ol><li>Durchführung von Western-Blotting von Proteinproben zusammen mit Standards.</li>
	<li>Führen Sie eine Quantifizierung des GFP nach dem Verhältnis zu Standards mit der Graustufenanalyse von ImageJ 1.5.0 durch.</li>
</ol>

Effiziente Extraktion und Reinigung von GFP-His aus N. benthamiana-Blättern

<ol>
	<li>Zahmanova, G., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Green+biologics:+Harnessing+the+power+of+plants+to+produce+pharmaceuticals.">Green biologics: Harnessing the power of plants to produce pharmaceuticals.</a> Int J Mol Sci. 24 (24), 1757 (2023).</li><li>PREVAIL Writing Group. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=A+randomized,+controlled+trial+of+ZMapp+for+Ebola+virus+infection.">A randomized, controlled trial of ZMapp for Ebola virus infection.</a> N Engl J Med. 375 (15), 1448-1456 (2016).</li><li>Ma, J. K. C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Regulatory+approval+and+a+first-in-human+phase+I+clinical+trial+of+a+monoclonal+antibody+produced+in+transgenic+tobacco+plants.">Regulatory approval and a first-in-human phase I clinical trial of a monoclonal antibody produced in transgenic tobacco plants.</a> Plant Biotechnol J. 13 (8), 1106-1120 (2015).</li><li>Shanmugaraj, B., Rattanapisit, K., Manopwisedjaroen, S., Thitithanyanont, A., Phoolcharoen, W. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Monoclonal+antibodies+B38+and+H4+produced+in+Nicotiana+benthamiana+neutralize+SARS-CoV-2+in+vitro.">Monoclonal antibodies B38 and H4 produced in Nicotiana benthamiana neutralize SARS-CoV-2 in vitro.</a> Front Plant Sci. 11, 589995 (2020).</li><li>Takeyama, N., Kiyono, H., Yuki, Y. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Plant-based+vaccines+for+animals+and+humans:+Recent+advances+in+technology+and+clinical+trials.">Plant-based vaccines for animals and humans: Recent advances in technology and clinical trials.</a> Ther Adv Vaccines. 3 (5-6), 139-154 (2015).</li><li>Ward, B. J., S&#233;guin, A., Couillard, J., Tr&#233;panier, S., Landry, N. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Phase+III:+Randomized+observer-blind+trial+to+evaluate+lot-to-lot+consistency+of+a+new+plant-derived+quadrivalent+virus+like+particle+influenza+vaccine+in+adults+18-49+years+of+age.">Phase III: Randomized observer-blind trial to evaluate lot-to-lot consistency of a new plant-derived quadrivalent virus like particle influenza vaccine in adults 18-49 years of age.</a> Vaccine. 39 (10), 1528-1533 (2021).</li><li>Siriwattananon, K., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Plant-produced+receptor-binding+domain+of+SARS-CoV-2+elicits+potent+neutralizing+responses+in+mice+and+non-human+primates.">Plant-produced receptor-binding domain of SARS-CoV-2 elicits potent neutralizing responses in mice and non-human primates.</a> Front Plant Sci. 12, 682953 (2021).</li><li>Leblanc, Z., Waterhouse, P., Bally, J. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Plant-based+vaccines:+The+way+ahead.">Plant-based vaccines: The way ahead.</a> Viruses. 13 (1), 5 (2020).</li><li>Sethi, L., Kumari, K., Dey, N. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Engineering+of+plants+for+efficient+production+of+therapeutics.">Engineering of plants for efficient production of therapeutics.</a> Mol Biotechnol. 63 (12), 1125-1137 (2021).</li><li>Webster, D. E., Thomas, M. C. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Post-translational+modification+of+plant-made+foreign+proteins;+glycosylation+and+beyond.">Post-translational modification of plant-made foreign proteins; glycosylation and beyond.</a> Biotechnol Adv. 30 (2), 410-418 (2012).</li><li>Streatfield, S. J. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Approaches+to+achieve+high-level+heterologous+protein+production+in+plants.">Approaches to achieve high-level heterologous protein production in plants.</a> Plant Biotechnol J. 5 (1), 2-15 (2007).</li><li>Nandi, S., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Process+development+and+economic+evaluation+of+recombinant+human+lactoferrin+expressed+in+rice+grain.">Process development and economic evaluation of recombinant human lactoferrin expressed in rice grain.</a> Transgenic Res. 14 (3), 237-249 (2005).</li><li>Ullrich, K. K., Hiss, M., Rensing, S. A. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Means+to+optimize+protein+expression+in+transgenic+plants.">Means to optimize protein expression in transgenic plants.</a> Curr Opin Biotechnol. 32, 61-67 (2015).</li><li>Su, H., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Plant-made+vaccines+against+viral+diseases+in+humans+and+farm+animals.">Plant-made vaccines against viral diseases in humans and farm animals.</a> Front Plant Sci. 14, 1170815 (2023).</li><li>Agrawal, G. K., Jwa, N. S., Lebrun, M. H., Job, D., Rakwal, R. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Plant+secretome:+Unlocking+secrets+of+the+secreted+proteins.">Plant secretome: Unlocking secrets of the secreted proteins.</a> Proteomics. 10 (4), 799-827 (2010).</li><li>Kim, T., Gondr&#233;-Lewis, M. C., Arnaoutova, I., Loh, Y. P. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Dense-core+secretory+granule+biogenesis.">Dense-core secretory granule biogenesis.</a> Physiology. 21, 124-133 (2006).</li><li>Menkhaus, T. J., Bai, Y., Zhang, C., Nikolov, Z. L., Glatz, C. E. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Considerations+for+the+recovery+of+recombinant+proteins+from+plants.">Considerations for the recovery of recombinant proteins from plants.</a> Biotechnol Prog. 20 (4), 1001-1014 (2004).</li><li>Kim, S. T., Cho, K. S., Jang, Y. S., Kang, K. Y. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Two-dimensional+electrophoretic+analysis+of+rice+proteins+by+polyethylene+glycol+fractionation+for+protein+arrays.">Two-dimensional electrophoretic analysis of rice proteins by polyethylene glycol fractionation for protein arrays.</a> Electrophoresis. 22 (10), 2103-2109 (2001).</li><li>Xi, J., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Polyethylene+glycol+fractionation+improved+detection+of+low-abundant+proteins+by+two-dimensional+electrophoresis+analysis+of+plant+proteome.">Polyethylene glycol fractionation improved detection of low-abundant proteins by two-dimensional electrophoresis analysis of plant proteome.</a> Phytochemistry. 67 (21), 2341-2348 (2006).</li><li>Dani, V., Simon, W. J., Duranti, M., Croy, R. R. D. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Changes+in+the+tobacco+leaf+apoplast+proteome+in+response+to+salt+stress.">Changes in the tobacco leaf apoplast proteome in response to salt stress.</a> Proteomics. 5 (3), 737-745 (2005).</li><li>Delaunois, B., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Uncovering+plant-pathogen+crosstalk+through+apoplastic+proteomic+studies.">Uncovering plant-pathogen crosstalk through apoplastic proteomic studies.</a> Front Plant Sci. 5, 249 (2014).</li><li>Andreasson, E., Abreha, K. B., Resj&#246;, S. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Isolation+of+apoplast.">Isolation of apoplast.</a> Methods Mol. Biol. 1511, 233-240 (2017).</li><li>Lohaus, G., Pennewiss, K., Sattelmacher, B., Hussmann, M., Hermann, M. K. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Is+the+infiltration-centrifugation+technique+appropriate+for+the+isolation+of+apoplastic+fluid?+A+critical+evaluation+with+different+plant+species.">Is the infiltration-centrifugation technique appropriate for the isolation of apoplastic fluid? A critical evaluation with different plant species.</a> Physiol Plant. 111 (4), 457-465 (2001).</li><li>Nouchi, I., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Overcoming+the+difficulties+in+collecting+apoplastic+fluid+from+rice+leaves+by+the+infiltration-centrifugation+method.">Overcoming the difficulties in collecting apoplastic fluid from rice leaves by the infiltration-centrifugation method.</a> Plant Cell Physiol. 53 (9), 1659-1668 (2012).</li><li>Rumyantseva, N. I., Valieva, A. I., Kostyukova, Y. A., Ageeva, M. V. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+effect+of+leaf+plasticity+on+the+isolation+of+apoplastic+fluid+from+leaves+of+tartary+buckwheat+plants+grown+in+vivo+and+in+vitro.">The effect of leaf plasticity on the isolation of apoplastic fluid from leaves of tartary buckwheat plants grown in vivo and in vitro.</a> Plants. 12 (23), 4048 (2023).</li><li>Ekanayake, G., Gohmann, R., Mackey, D. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=A+method+for+quantitation+of+apoplast+hydration+in+Arabidopsis+leaves+reveals+water-soaking+activity+of+effectors+of+Pseudomonas+syringae+during+biotrophy.">A method for quantitation of apoplast hydration in Arabidopsis leaves reveals water-soaking activity of effectors of Pseudomonas syringae during biotrophy.</a> Sci Rep. 12 (1), 18363 (2022).</li><li>Preston, G. M., Fones, H. N., Mccraw, S., Rico, A., O'leary, B. M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+infiltration-centrifugation+technique+for+extraction+of+apoplastic+fluid+from+plant+leaves+using+phaseolus+vulgaris+as+an+example.">The infiltration-centrifugation technique for extraction of apoplastic fluid from plant leaves using phaseolus vulgaris as an example.</a> J Vis Exp. (94), e52113 (2014).</li><li>Nandi, S., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Process+development+and+economic+evaluation+of+recombinant+human+lactoferrin+expressed+in+rice+grain.">Process development and economic evaluation of recombinant human lactoferrin expressed in rice grain.</a> Transgenic Res. 14 (3), 237-249 (2005).</li><li>Menkhaus, T. J., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Considerations+for+the+recovery+of+recombinant+proteins+from+plants.">Considerations for the recovery of recombinant proteins from plants.</a> Biotechnol Prog. 20 (4), 1001-1014 (2004).</li><li>Streatfield, S. J. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Approaches+to+achieve+high-level+heterologous+protein+production+in+plants.">Approaches to achieve high-level heterologous protein production in plants.</a> Plant Biotechnol J. 5 (1), 2-15 (2007).</li><li>Yamamoto, T., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Improvement+of+the+transient+expression+system+for+production+of+recombinant+proteins+in+plants.">Improvement of the transient expression system for production of recombinant proteins in plants.</a> Sci Rep. 8 (1), 4755 (2018).</li><li>Zhao, J., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Wheat+Apoplast-localized+lipid+transfer+protein+TaLTP3+enhances+defense+responses+against+Puccinia+triticina.">Wheat Apoplast-localized lipid transfer protein TaLTP3 enhances defense responses against Puccinia triticina.</a> Front Plant Sci. 12, 771806 (2021).</li><li>Venkataraman, S., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Recent+advances+in+expression+and+purification+strategies+for+plant+made+vaccines.">Recent advances in expression and purification strategies for plant made vaccines.</a> Front Plant Sci. 14, 1273958 (2023).</li><li>Witzel, K., Shahzad, M., Matros, A., Mock, H. P., M&#252;hling, K. H. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Comparative+evaluation+of+extraction+methods+for+apoplastic+proteins+from+maize+leaves.">Comparative evaluation of extraction methods for apoplastic proteins from maize leaves.</a> Plant Meth. 7, 48 (2011).</li></ol>

Die Autoren erklären, dass kein Interessenkonflikt besteht.

Die Verwendung von Pflanzen zur Herstellung therapeutischer Proteine hat in den letzten Jahren schnell zugenommen 1,2,3,4,5,6. Proteinkodierende Gene werden in Expressionsvektoren kloniert und über Agroinfiltration in pflanzliches Gewebe abgegeben. Nach der Produktion durch Pflanzenzellen werden Proteine für nachgelagerte A...

Heutzutage werden verschiedene pflanzlich produzierte rekombinante therapeutische Proteine untersucht, darunter Antikörper, Impfstoffe, bioaktive Proteine, Enzyme und kleine Polypeptide 1,2,3,4,5,6. Pflanzen werden aufgrund ihrer Sicherheit, ihrer geringen Kosten und ihrer Fähigkeit, die Produktion schnell zu skalieren, zu einer zunehmend genutzten Plattform für die Herstellung therapeutischer Proteine 7,8. Die Proteinexpression und -modifikation in pflanzlichen Systemen sind zusammen mit der Proteinreinigung kritische Faktoren, die die Produktivität von pflanzlichen Bioreaktoren bestimmen 9,10. Die Steigerung der Pflanzenproduktivität und die Gewinnung hochreiner Zielproteine sind zentrale Herausforderungen für pflanzenbasierte Produktionssysteme11,12.
Die subzelluläre Lokalisierung und Modifikation rekombinanter Proteine hängt von dem spezifischen Signalpeptid ab, das am N-Terminus kodiert ist und das Protein während der Genexpression zu seinem endgültigen Organellenziel führt. Rekombinante Proteine sind so konzipiert, dass sie aufgrund ihrer einzigartigen Eigenschaften im Apoplasten, im endoplasmatischen Retikulum (ER), im Chloroplasten, in der Vakuole oder im Zytoplasma lokalisiertsind 13. Bei Antigenen und Antikörpern werden sekretierte Proteine bevorzugt. Vor der Sekretion durchlaufen die Proteine ER und Golgi für eine korrekte Faltung und posttranslationale Modifikationen 14,15,16.
Nach der Produktion in Pflanzen müssen rekombinante Proteine aus Pflanzenextrakten gereinigt werden. Typischerweise werden Proteine aus vollständig löslichen Pflanzenextrakten gereinigt, die reichlich intrazelluläre Proteine, fehlgefaltete und unmodifizierte Produkte und Cytochrome enthalten17. Um Verunreinigungen zu entfernen, werden Pflanzenextrakte einer umfangreichen Fraktionierung unterzogen, einschließlich einer Ribulose-1,5-Bisphosphat-Carboxylase/Oxygenase (RuBisCO)-spezifischen Affinitätschromatographie, Phytatfällung, Polyethylenglykolfällung und Einstellung von Temperatur und pH18,19. Solche Schritte zur Entfernung von Verunreinigungen sind mühsam und können die Proteinqualität beeinträchtigen.
Das pflanzliche Zellkompartiment jenseits der Plasmamembran wird als Apoplast definiert und umfasst die Zellwand, die Interzellularräume und das Xylem20. Die wässrige Phase wird allgemein als Apoplast-Waschflüssigkeit (AWF) bezeichnet. AWF enthält Moleküle, die von Zellen sezerniert werden, um zahlreiche biologische Prozesse wie Transport, Zellwandstoffwechsel und Stressreaktionen zu regulieren21,22. Im Gegensatz zu TSP sind die molekularen Bestandteile von AWF weniger komplex. Die Extraktion rekombinanter Proteine aus AWF kann eine Kontamination durch intrazelluläre Proteine, fehlgefaltete Produkte und zytoplasmatische Überreste vermeiden. Kurz gesagt, das Extraktionslipid gelangt unter Unterdruck durch die Spaltöffnungen in die Blätter, und das AWF wird durch schonende Zentrifugationaufgefangen 23. Während die Isolierung von AWF weit verbreitet ist, um den biologischen Fortschritt in Apoplast 24,25,26,27 zu untersuchen, wurde sie in pflanzlichen Produktionssystemen nicht genutzt.
Die Verbesserung der Pflanzenproduktivität und die Gewinnung hochreiner Zielproteine sind zentrale Herausforderungen für pflanzliche Produktionssysteme28. Typischerweise werden Proteine aus vollständig löslichen Pflanzenextrakten gereinigt, die große Mengen an intrazellulären Proteinen, fehlgefalteten und unmodifizierten Produkten und Cytochromenenthalten 29, was hohe Kosten für die anschließende Reinigungerfordert 30. Die Verwendung von AWF-Proteinextraktionsmethoden zur Extraktion exogener rekombinanter Proteine, die in Apoplasten sezerniert werden, kann die Homogenität rekombinanter Proteine effektiv verbessern und die Kosten für die Proteinreinigung senken. Hier verwenden wir ein Signalpeptid PR1a, um eine exogene Proteinsekretion in den Apoplastenraum zu ermöglichen und stellen eine detaillierte Methode zur rekombinanten Proteinreinigung aus dem AWF von N. benthamiana vor.

<table border="1" fo:keep-together.within-page="1" fo:keep-with-next.within-page="always">
	<tbody>
		<tr>
			<td>100 mesh nylon fine mesh yarn</td>
			<td>Guangzhou Huayu Trading limited company</td>
			<td>hy-230724-2</td>
			<td>For AWF protein extraction</td>
		</tr>
		<tr>
			<td>50 ml centrifuge tubes</td>
			<td>Vazyme</td>
			<td>TCF00150</td>
			<td>For centrifuge</td>
		</tr>
		<tr>
			<td>ClonExpress II one step cloning kit</td>
			<td>Vazyme</td>
			<td>C112-02</td>
			<td>For clone</td>
		</tr>
		<tr>
			<td>FastDigest Sac1</td>
			<td>NEB</td>
			<td>R3156S</td>
			<td>For clone</td>
		</tr>
		<tr>
			<td>FastDigest XbaI</td>
			<td>NEB</td>
			<td>FD0685</td>
			<td>For clone</td>
		</tr>
		<tr>
			<td>ImageJ 1.5.0</td>
			<td>/</td>
			<td>/</td>
			<td>For greyscale analysis</td>
		</tr>
		<tr>
			<td>Large filter</td>
			<td>Thermo Fisher</td>
			<td>NEST</td>
			<td>For filtering</td>
		</tr>
		<tr>
			<td>Laser scanning confocal microscopy</td>
			<td>Leica SP8</td>
			<td></td>
			<td>For subcellular localization</td>
		</tr>
		<tr>
			<td>Ni sepharose excel</td>
			<td>Cytiva</td>
			<td>10339806</td>
			<td>For protein purification</td>
		</tr>
		<tr>
			<td>Precast protein plus gel</td>
			<td>YEASEN</td>
			<td>36246ES10</td>
			<td>For SDS-PAGE</td>
		</tr>
		<tr>
			<td>Small filter</td>
			<td>Nalgene</td>
			<td>1660045</td>
			<td>For filtering</td>
		</tr>
		<tr>
			<td>SuperSignal West Femto Substrate Trial Kit</td>
			<td>Thermo Fisher</td>
			<td>34076</td>
			<td>For western blotting</td>
		</tr>
		<tr>
			<td>Triton X-100</td>
			<td>SCR</td>
			<td>30188928</td>
			<td>To configure the extraction buffer</td>
		</tr>
		<tr>
			<td>Type rotaryvang vacuum pump</td>
			<td>Zhejiang taizhouqiujing vacuum pump limited company</td>
			<td>2XZ-2</td>
			<td>For vacuum infiltration</td>
		</tr>
		<tr>
			<td>Vertical mixer</td>
			<td>Haimen Qilinbel Instrument Manufacturing limited company</td>
			<td>BE-1200</td>
			<td>For mixing</td>
		</tr>
		<tr>
			<td>&#946;-mercaptoethanol</td>
			<td>SIGMA</td>
			<td>BCBK8223V</td>
			<td>To configure the extraction buffer</td>
		</tr>
	</tbody>
</table>

apoplast-extraction based method to improve the purity of plant produced recombinant protein  

Pflanzen sind ein neu entwickeltes eukaryotisches Expressionssystem, das zur Herstellung therapeutischer Proteine erforscht wird. Die Reinigung von rekombinanten Proteinen aus Pflanzen ist einer der kritischsten Schritte im Produktionsprozess. In der Regel wurden Proteine aus vollständig löslichen Proteinen (TSP) gereinigt, und das Vorhandensein verschiedener intrazellulärer Proteine und Cytochrome stellt eine Herausforderung für nachfolgende Proteinreinigungsschritte dar. Darüber hinaus werden die meisten therapeutischen Proteine wie Antigene und Antikörper sezerniert, um eine ordnungsgemäße Glykosylierung zu erhalten, und das Vorhandensein unvollständig modifizierter Proteine führt zu inkonsistenten Antigen- oder Antikörperstrukturen. In dieser Arbeit wird eine effektivere Methode zur Gewinnung hochreiner rekombinanter Proteine aus dem apoplastischen Pflanzenraum vorgestellt. Das rekombinante grün fluoreszierende Protein (GFP) wird so verändert, dass es in den Apoplasten von Nicotiana benthamiana sezerniert und dann mit einer Infiltrations-Zentrifugationsmethode extrahiert wird. Das GFP-His aus dem extrahierten Apoplasten wird dann durch Nickel-Affinitätschromatographie aufgereinigt. Im Gegensatz zu den traditionellen Methoden von TSP entstehen bei der Aufreinigung aus dem Apoplasten hochreine rekombinante Proteine. Dies stellt eine wichtige technologische Verbesserung für pflanzliche Produktionssysteme dar.

Nowadays, various plant-produced recombinant therapeutic proteins are under study, including antibodies, vaccines, bioactive proteins, enzymes, and small polypeptides1,2,3,4,5,6. Plants are becoming an increasingly utilized platform for producing therapeutic proteins due to their safety, low cost, and ability to rapidly scale production7,8. Protein expression and modification in plant systems, along with protein purification, are critical factors determining the productivity of plant bioreactors9,10. Enhancing plant productivity and obtaining high-purity target proteins are core challenges facing plant-based production systems11,12.
The subcellular localization and modification of recombinant proteins depends on the specific signal peptide encoded at the N-terminus, which targets the protein to its final organelle destination during gene expression. Recombinant proteins are designed to localize to the apoplast, endoplasmic reticulum (ER), chloroplast, vacuole, or cytoplasm, based on their unique properties13. For antigens and antibodies, secreted proteins are preferred. Before secretion, proteins progress through ER and Golgi for correct folding and post-translational modifications14,15,16.
After production in plants, recombinant proteins must be purified from plant extracts. Typically, proteins are purified from total soluble plant extracts, which contain abundant intracellular proteins, misfolded and unmodified products, and cytochromes17. To remove impurities, plant extracts undergo extensive fractionation, including ribulose-1,5-bisphosphate carboxylase/oxygenase (RuBisCO)-specific affinity chromatography, phytate precipitation, polyethylene glycol precipitation, and adjustment of temperature and pH18,19. Such impurity-removal steps are laborious and can compromise protein quality.
The plant cell compartment beyond the plasma membrane is defined as the apoplast, encompassing the cell wall, intercellular spaces, and xylem20. The aqueous phase is commonly called apoplast washing fluid (AWF). AWF contains molecules secreted by cells to regulate numerous biological progresses like transport, cell wall metabolism, and stress responses21,22. In contrast to TSP, the molecular constituents of AWF are less complex. Extracting recombinant proteins from AWF may avoid contamination by intracellular proteins, misfolded products, and cytoplasmic remnants. Briefly, extraction lipid enters leaves through the stomata under negative pressure, and the AWF is collected by gentle centrifugation23. While isolation of AWF is widely employed to study the biological progress inside apoplast24,25,26,27, it has not been exploited in plant-based production systems.
Improving plant productivity and obtaining high purity target proteins are central challenges for plant production systems28. Typically, proteins are purified from total soluble plant extracts containing large amounts of intracellular proteins, misfolded and unmodified products, and cytochromes29, which require great costs for subsequent purification30. The use of AWF protein extraction methods for the extraction of exogenous recombinant proteins secreted into apoplast can effectively improve the homogeneity of recombinant proteins and reduce the cost of protein purification. Here, we use a signal peptide PR1a to enable exogenous protein secretion into the apoplast space and introduce a detailed method for recombinant protein purification from the AWF of N. benthamiana.

Autor im Rampenlicht: Optimierung der Apoplast Proteinextraktion für die effiziente Rückgewinnung rekombinanter Proteine aus Pflanzenzellen

Auf Apoplast-Extraktion basierende Methode zur Verbesserung der Reinheit von pflanzlich produzierten rekombinanten Proteinen  

We investigated how to extract recombinant proteins from plant cells more efficiently. We answered the question of whether the apoplast protein extraction method is feasible when applied to the recombinant proteins. This extraction method extracts proteins secreted into the apoplast, so they have homogeneity.There is no need for cell disruption, which reduce the interference from intracellular proteins and the subsequent purification costs. We will focus on how to increase the secretion of recombinant proteins in the apoplast space to further improve the efficiency of the apoplast protein extraction method.

GFP-His ist für die Sekretion in den apoplastischen Raum von N. benthamiana bestimmt GFP wurde mit einem N-terminalen PR1a-Signalpeptid für die Sekretion und einem C-terminalen His-Tag für die Aufreinigung in das pCAMBIA1300-Plasmid kloniert, wodurch p35s-PR1a-GFP-His erzeugt wurde (Abbildung 1A). Das rekombinante Protein wurde transient in N. benthamiana exprimiert, und eine 30 kDa-Bande wurde 3 Tage nach der Agroinfiltration mittels...

Die Aufreinigung rekombinanter Proteine aus pflanzlichen Systemen wird in der Regel durch pflanzliche Proteine herausgefordert. Diese Arbeit stellt eine Methode zur effektiven Extraktion und Reinigung eines sekretierten rekombinanten Proteins aus dem Apoplast von Nicotiana benthamiana dar.

Plants are a newly developing eukaryotic expression system being explored to produce therapeutic proteins. Purification of recombinant proteins from ...

apoplast-extraction-based-method-to-improve-purity-plant-produced

Research

JoVE Journal

Biology

Apoplast-Extraction Based Method to Improve the Purity of Plant Produced Recombinant Protein  

649 Aufrufe.  Shandong First Medical University. Wir haben untersucht, wie man rekombinante Proteine effizienter aus Pflanzenzellen extrahieren kann. Wir beantworteten die Frage, ob die Methode der Apoplast-Proteinextraktion praktikabel ist, wenn sie auf die rekombinanten Proteine angewendet wird. Bei dieser Extraktionsmethode werden Proteine extrahiert, die in den Apopen sezerniert werden, so dass sie Homogenität aufweisen.Es ist kein Zellaufschluss erforderlich, wodurch die Interferenz durch intra...