Diese Arbeit wurde durch die Department of Veterans Affairs Rehab R&D Service Career Development Awards (CDA-1, RX002111; CDA-2; RX002928) zu RSA und (CDA-2, RX002342) zu AJF und den National Institutes of Health (NIH-NICHD F31 HD097918 zu DACT und NIH-NIEHS T32 ES012870 zu DACT) und NEI Core Grant P30EY006360.

Alle Verfahren wurden vom Atlanta Veterans Affairs Institutional Animal Care and Use Committee genehmigt und entsprachen dem Leitfaden der National Institutes of Health für die Pflege und Verwendung von Labortieren (NIH Publications, 8. Auflage, aktualisiert 2011).
1. Die optomotorische Reaktion (OMR)
<ol><li>Einrichten des OMR-Geräts (Details zu Gerät und Software in der Materialtabelle)
	<ol>
<li>Wählen Sie die plattformgerechte Größe für das Nagetier: Maus, Ratte oder große/beeinträchtigte Ratte (Abbildung 1A).</li>
		<li>Öffnen Sie die OMR-Software, die sich zu einem Fenster mit mehreren Registerkarten mit Optionen und einem Live-Video-Feed des Inneren der OMR/virtuellen Trommel öffnen sollte (Abbildung 1B). Zoomen Sie mit der Videokamera nach Bedarf hinein oder heraus, damit die Plattform und ihre Umgebung sichtbar sind.</li>
		<li>Beachten Sie die Symbole auf der linken Seite des Livebilds (Abbildung 1C). Klicken Sie auf das Sternchensymbol und das Symbol für rotierende Streifen, sodass sowohl das grüne Sternchen als auch die grünen rotierenden Streifen aus dem Live-Feed verschwinden.</li>
		<li>Klicken Sie auf das Kompasssymbol , damit ein grüner Kreis und zwei senkrechte Linien angezeigt werden. Dehnen Sie den grünen Kreis so, dass er perfekt mit dem schwarzen Kreis auf der Plattform übereinstimmt, wodurch sichergestellt wird, dass der OMR perfekt ausgerichtet ist.</li>
		<li>Klicken Sie auf das Kompasssymbol , da es nicht notwendig ist, den Kreis während des Tests zu sehen. Klicken Sie auf das grüne Sternchensymbol und das grüne Symbol für rotierende Streifen , damit diese wieder angezeigt werden. Beachten Sie, dass sich die grünen Streifen in die gleiche Richtung drehen wie die Streifen in der Trommel, so dass der Forscher die Richtung der Streifen kennen kann.</li>
		<li>Klicken Sie auf die Registerkarte Testen . Klicken Sie unter Testen auf die Registerkarte Psychophysik . Wählen Sie unter Schwellenwert die Option Frequenz aus, um die Ortsfrequenz zu messen. HINWEIS: Die OMR-Software verwendet ein Treppenparadigma, um die Ortsfrequenz (SF) automatisch zu berechnen. Der Kontrast wird bei 100% gehalten.</li>
		<li>Klicken Sie unter Testen auf die Registerkarte Vorgaben . Wählen Sie die Standardeinstellungen für Mouse18 oder Rat20 aus.</li>
		<li>Klicken Sie unter Testen auf die Registerkarte Ausblenden . Aktivieren Sie das Kontrollkästchen Blank on Tracking , um die Streifen anzuhalten / die Computerbildschirme in der Trommel auszublenden, wenn die Maus mit der rechten Maustaste angeklickt wird.</li>
		<li>Klicken Sie auf die Registerkarte Ergebnisse , auf der die Ergebnisse des Tests angezeigt werden.</li>
	</ol></li>
	<li>Raumfrequenz auswerten
	<ol>
<li>Platzieren Sie das Nagetier auf der kreisförmigen Plattform in der Mitte der Virtual-Reality-Kammer, die aus vier Computermonitoren besteht, die vertikale Sinuswellengitter zeigen, die die Kammer mit einer Geschwindigkeit von 12 ° / s umkreisen (Abbildung 1D).</li>
		<li>Beachten Sie, dass die Videokamera, die oben in der Kammer positioniert ist, das Verhalten des Nagetiers live auf den Computermonitor projiziert.</li>
		<li>Achten Sie auf das Vorhandensein oder Fehlen reflexiver Handlungen des Nagetierkopfes, wenn sich die Gitter im Uhrzeigersinn oder gegen den Uhrzeigersinn bewegen. Stellen Sie sicher, dass illustrierte Balken im Programm sichtbar sind – diese zeigen die Richtung der Gitterbewegung an.<ol>
<li>Achten Sie darauf, dass sich der Kopf des Nagetiers in die gleiche Richtung wie die Gitter bewegt. Warten Sie, bis es eine reibungslose Verfolgung gibt, keine unberechenbaren Ausbrüche von Kopfbewegungen, um es als Tracking zu zählen.</li>
			<li>Klicken Sie auf Ja oder Nein . Beachten Sie, dass SF mit 0,042 cyc/deg beginnt und sich mit jedem Ja und Nein anpasst, um einfacher oder schwieriger zu werden (Abbildung 1E). Klicken Sie auf Zurücksetzen , wenn der Test aufgrund eines versehentlichen oder falschen Klickens von Ja und Nein zurückgesetzt werden muss.</li>
		</ol>
</li>
		<li>Wenn das Nagetier getestet wird, achten Sie darauf, das Sternchen über dem Kopf des Nagetiers zu halten. HINWEIS: Dies hat zwei Auswirkungen: 1) Es behält die korrekte Ortsfrequenz bei. Wenn das Sternchen beispielsweise zwischen den Schultern positioniert ist, ist die Ortsfrequenz niedriger und die Balken sind leichter zu sehen, was zu einer falsch hohen Punktzahl führt. 2) Bei Nagetieren mit leichten Kopfbewegungen lässt sich das Sternchen leichter beurteilen, ob sich der Kopf tatsächlich bewegt.</li>
		<li>Achten Sie darauf, dass das System "Fertig" sagt, wenn die Ortsfrequenz des Nagetiers erreicht ist. Beachten Sie, dass die Schaltflächen Ja und Nein nicht mehr angeklickt werden können.</li>
		<li>Klicken Sie auf die Registerkarte Ergebnisse , auf der die Ortsfrequenz für das linke Auge, das rechte Auge und die kombinierten Augen angezeigt wird. HINWEIS: Manchmal ist die Software so eingestellt, dass die Ergebnisse umgedreht werden, d.h. das rechte Auge wird als das linke Auge und das linke Auge als das rechte Auge gemeldet. Dies wurde bei der Beurteilung von Nagetieren entdeckt, die in einem Glaukommodell nur eine Augenlähmung aufwiesen.</li>
	</ol></li>
	<li>Bewerten der Kontrastempfindlichkeit HINWEIS: Der Kontrastempfindlichkeitstest kann unmittelbar nach dem Schritt der Ortsfrequenzmessung oder allein am selben Tag oder an einem anderen Tag durchgeführt werden, wenn das Nagetier nach der Ortsfrequenzprüfung ermüdet erscheint (befolgen Sie die Schritte 1 bis 2.2, wenn Sie nur die Kontrastempfindlichkeit testen).<ol>
<li>Klicken Sie auf die Registerkarte Tests und dann auf die Registerkarte Psychophysik . Wählen Sie unter Schwellenwert die Option Kontrast (einzeln) aus, um die Kontrastempfindlichkeit zu messen.</li>
		<li>Beginnen Sie auch mit einem Treppenparadigma Gitter mit SF-Konstante auf dem Höhepunkt der CS-Kurve (Contrast Sensitivity). Klicken Sie dazu auf die Registerkarte Stimulus und dann auf die Registerkarte Gitter . Geben Sie im Feld Ortsfrequenz den Wert 0,064 für Ratten und 0,103 für Mäuse ein.</li>
		<li>Beginnen Sie den Kontrast bei 100% und suchen Sie nach den gleichen reflexiven Kopfbewegungen wie bei der Ortsfrequenzprüfung. Beachten Sie, dass der Kontrast im Laufe der Tests abnimmt, bis das Nagetier keine reflexiven Kopfbewegungen mehr als Reaktion auf den Reiz hat (Abbildung 1E).</li>
		<li>Achten Sie darauf, dass das System "Fertig" sagt und die Tasten Ja und Nein nicht mehr anklickbar sind, sobald das Nagetier nicht mehr auf den visuellen Reiz reagiert und die Kontrastempfindlichkeitsschwelle erreicht wurde. Klicken Sie auf die Registerkarte Ergebnisse , wo die Kontrastempfindlichkeit für das linke Auge, das rechte Auge und die kombinierten Augen aufgelistet wird.</li>
	</ol></li>
	<li>Durchführen einer Analyse nach dem Testen
	<ol>
<li>Für diabetische Retinopathie-Studien, bei denen erwartet wird, dass beide Augen ähnliche Defizite aufweisen, verwenden Sie den kombinierten Score (Durchschnitt des rechten und linken Auges) für die Analyse. Für Modelle, die eine differentielle Schädigung der Augen verursachen (z. B. Explosionsverletzung oder Glaukom), halten Sie die Daten des linken und rechten Auges getrennt.</li>
		<li>Verwenden Sie für Die Räumliche Frequenz die Rohwerte (die Daten von der Registerkarte Ergebnisse ) für die Analyse und berechnen Sie diese Werte zusammen nach Gruppen (z. B. Diabetiker, Kontrollwerte usw.).</li>
		<li>Verwenden Sie für Die Kontrastempfindlichkeit den Rohwert, um die gemeldete Kontrastempfindlichkeit durch den Michelson-Kontrast aus einer vorherigen Messung der Luminanz des Bildschirms zu berechnen.</li>
	</ol></li>
</ol>2. Das Y-Labyrinth
<ol><li>
Bereiten Sie Nagetiere für die Prüfung vor
	<ol>
<li>Passen Sie Nagetiere vor dem Test 30 Minuten lang an den Raum an. HINWEIS: Der Forscher kann bei eingeschaltetem Licht im Raum bleiben, sollte aber während dieser Zeit stumm bleiben.</li>
		<li>Reinigen Sie das Y-Labyrinth mit einer für Tiere sicheren Desinfektionslösung und wischen Sie alle Desinfektionslösungen mit Papiertüchern ab. Stellen Sie sicher, dass das Labyrinth trocken ist.</li>
	</ol>
</li>
	<li>
Führe das Y-Labyrinth durch
	<ol>
<li>Beschriften Sie den Anfangsarm des Y-Labyrinths als B und die anderen 2 Arme als A und C (Abbildung 2A). Legen Sie ein Nagetier in den Arm, der dem Forscher am nächsten ist (Arm B) in der Nähe der Mitte des Y-Labyrinths. Sobald das Nagetier platziert wurde, starten Sie den Timer (Details zu Labyrinth und Timer in der Materialtabelle).<ol>
<li>Erlauben Sie jedem Nagetier, das Y-Labyrinth für 8 Minuten zu erkunden. Machen Sie während dieser Zeit Aufnahmen und notieren Sie alle Beobachtungen. Setzen Sie sich mehrere Meter vom Labyrinth entfernt, während Sie es in Sichtweite halten und keinen Lärm machen.</li>
			<li>Notieren Sie den Startort als A, und jedes Mal, wenn das Nagetier in einen neuen Arm eintritt, notieren Sie den neuen Standort des Nagetiers (Abbildung 2B). Definieren Sie einen Eintrag als alle vier Gliedmaßen des Nagetiers, die sich in einem der Arme befinden.</li>
			<li>Achten Sie darauf, dass sich Nagetiere verstecken und in einem Arm des Labyrinths stationär bleiben. Wenn das Nagetier länger als 60 s an der gleichen Stelle bleibt und kein Erkundungsverhalten zu zeigen scheint, bewegen Sie das Nagetier in Richtung des Zentrums des Y-Labyrinths und setzen Sie den Versuch fort.</li>
		</ol>
</li>
		<li>Entfernen Sie nach jedem Nagetier alle Fäkalien und reinigen Sie das Labyrinth mit Desinfektionslösung.<ol>
<li>Stellen Sie sicher, dass alle Desinfektionslösungen mit Papiertüchern abgewischt werden und das Labyrinth vollständig trocken ist, bevor Sie das nächste Nagetier in das Labyrinth legen.</li>
		</ol>
</li>
	</ol>
</li>
	<li>
Spontanes Wechsel- und Erkundungsverhalten berechnen
	<ol>
<li>Berechnen Sie das explorative Verhalten als die Gesamtzahl der Einträge, die während 8 Minuten getätigt wurden.</li>
		<li>Berechnen Sie die räumliche Kognition, gemessen durch spontanen Wechsel: die Anzahl der erfolgreichen Änderungen/(die Gesamtzahl der Einträge - 2)<ol>
<li>Definieren Sie eine erfolgreiche Abwechslung, während sich das Nagetier nacheinander an drei verschiedenen Orten bewegt (Beispiel: ABC, CAB, BCA usw.). Notieren Sie sich jede erfolgreiche Abwechslung (Abbildung 2B).</li>
			<li>Wenn die Bewegungen als ACABCABABCABC aufgezeichnet wurden, ignorieren Sie die beiden anfänglichen Startorte bei der Berechnung des spontanen Wechsels (so dass sich 11 Bewegungen im Nenner befinden). Zählen Sie die Anzahl der genauen Bewegungen (genaue Bewegungen = 8). Berechnen Sie die prozentuale Genauigkeit als: 8/(13 - 2) = 72,7%.</li>
		</ol>
</li>
	</ol>
</li>
</ol>

<ol>
	<li>. International Diabetes Federation Diabetes Atlas, 9th edn Available from: <a target="_blank" href="https://diabetesatlas.org/upload/resources/material/20200302_133351_IDFATLAfinal-web.pdf">https://diabetesatlas.org/upload/resources/material/20200302_133351_IDFATLAfinal-web.pdf</a> (2019)</li><li>Wang, W., Lo, A. C. Y. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Diabetic+retinopathy:+pathophysiology+and+treatments.">Diabetic retinopathy: pathophysiology and treatments.</a> International Journal of Molecular Sciences. 19 (6), (2018).</li><li>Akpek, E. K., Smith, R. A. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Overview+of+age-related+ocular+conditions.">Overview of age-related ocular conditions.</a> The American Journal of Managed Care. 19 (5), 67-75 (2013).</li><li>Urano, F. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Wolfram+syndrome:+diagnosis,+management,+and+treatment.">Wolfram syndrome: diagnosis, management, and treatment.</a> Current Diabetes Reports. 16 (1), 6 (2016).</li><li>Adeva-Andany, M. M., Funcasta-Calder&#243;n, R., Fern&#225;ndez-Fern&#225;ndez, C., Ameneiros-Rodr&#237;guez, E., Dom&#237;nguez-Montero, A. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Subclinical+vascular+disease+in+patients+with+diabetes+is+associated+with+insulin+resistance.">Subclinical vascular disease in patients with diabetes is associated with insulin resistance.</a> Diabetes &amp; Metabolic Syndrome: Clinical Research &amp; Reviews. 13 (3), 2198-2206 (2019).</li><li>Chin, J. A., Sumpio, B. E. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Diabetes+mellitus+and+peripheral+vascular+disease:+diagnosis+and+management.">Diabetes mellitus and peripheral vascular disease: diagnosis and management.</a> Clinics in Podiatric Medicine and Surgery. 31 (1), 11-26 (2014).</li><li>Barber, A. J., Gardner, T. W., Abcouwer, S. F. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+significance+of+vascular+and+neural+apoptosis+to+the+pathology+of+diabetic+retinopathy.">The significance of vascular and neural apoptosis to the pathology of diabetic retinopathy.</a> Investigative Ophthalmology &amp; Visual Science. 52 (2), 1156-1163 (2011).</li><li>Pardue, M. T., Allen, R. S. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Neuroprotective+strategies+for+retinal+disease.">Neuroprotective strategies for retinal disease.</a> Progress in Retinal and Eye Research. 65, 50-76 (2018).</li><li>Aung, M. H., Kim, M. K., Olson, D. E., Thule, P. M., Pardue, M. T. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Early+visual+deficits+in+streptozotocin-induced+diabetic+long+evans+rats.">Early visual deficits in streptozotocin-induced diabetic long evans rats.</a> Investigative Ophthalmology &amp; Visual Science. 54 (2), 1370-1377 (2013).</li><li>Antonetti, D. A., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Diabetic+retinopathy:+seeing+beyond+glucose-induced+microvascular+disease.">Diabetic retinopathy: seeing beyond glucose-induced microvascular disease.</a> Diabetes. 55 (9), 2401-2411 (2006).</li><li>Logroscino, G., Kang, J. H., Grodstein, F. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Prospective+study+of+type+2+diabetes+and+cognitive+decline+in+women+aged+70-81+years.">Prospective study of type 2 diabetes and cognitive decline in women aged 70-81 years.</a> BMJ. 328 (7439), 548 (2004).</li><li>London, A., Benhar, I., Schwartz, M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+retina+as+a+window+to+the+brain-from+eye+research+to+CNS+disorders.">The retina as a window to the brain-from eye research to CNS disorders.</a> Nature Reviews Neurology. 9 (1), 44-53 (2013).</li><li>Archibald, N. K., Clarke, M. P., Mosimann, U. P., Burn, D. J. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+retina+in+Parkinson's+disease.">The retina in Parkinson's disease.</a> Brain. 132 (5), 1128-1145 (2009).</li><li>Sakai, R. E., Feller, D. J., Galetta, K. M., Galetta, S. L., Balcer, L. J. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Vision+in+multiple+sclerosis:+the+story,+structure-function+correlations,+and+models+for+neuroprotection.">Vision in multiple sclerosis: the story, structure-function correlations, and models for neuroprotection.</a> Journal of Neuroophthalmology. 31 (4), 362-373 (2011).</li><li>Wong, T. Y., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Retinal+microvascular+abnormalities+and+incident+stroke:+the+Atherosclerosis+Risk+in+Communities+Study.">Retinal microvascular abnormalities and incident stroke: the Atherosclerosis Risk in Communities Study.</a> The Lancet. 358 (9288), 1134-1140 (2001).</li><li>Marqui&#233;, M., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Association+between+retinal+thickness+and+&#946;-amyloid+brain+accumulation+in+individuals+with+subjective+cognitive+decline:+Fundaci&#243;+ACE+Healthy+Brain+Initiative.">Association between retinal thickness and &#946;-amyloid brain accumulation in individuals with subjective cognitive decline: Fundaci&#243; ACE Healthy Brain Initiative.</a> Alzheimer's Research &amp; Therapy. 12 (1), 37 (2020).</li><li>Thomas, B. B., Seiler, M. J., Sadda, S. R., Coffey, P. J., Aramant, R. B. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Optokinetic+test+to+evaluate+visual+acuity+of+each+eye+independently.">Optokinetic test to evaluate visual acuity of each eye independently.</a> Journal of Neuroscience Methods. 138 (1-2), 7-13 (2004).</li><li>Prusky, G. T., Alam, N. M., Beekman, S., Douglas, R. M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Rapid+quantification+of+adult+and+developing+mouse+spatial+vision+using+a+virtual+optomotor+system.">Rapid quantification of adult and developing mouse spatial vision using a virtual optomotor system.</a> Investigative Ophthalmology &amp; Vision Science. 45 (12), 4611-4616 (2004).</li><li>Maurice, T., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Behavioral+evidence+for+a+modulating+role+of+&#963;+ligands+in+memory+processes.+I.+Attenuation+of+dizocilpine+(MK-801)-induced+amnesia.">Behavioral evidence for a modulating role of &#963; ligands in memory processes. I. Attenuation of dizocilpine (MK-801)-induced amnesia.</a> Brain Research. 647 (1), 44-56 (1994).</li><li>Douglas, R. M., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Independent+visual+threshold+measurements+in+the+two+eyes+of+freely+moving+rats+and+mice+using+a+virtual-reality+optokinetic+system.">Independent visual threshold measurements in the two eyes of freely moving rats and mice using a virtual-reality optokinetic system.</a> Visual Neuroscience. 22 (5), 677-684 (2005).</li><li>Feola, A. J., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Menopause+exacerbates+visual+dysfunction+in+experimental+glaucoma.">Menopause exacerbates visual dysfunction in experimental glaucoma.</a> Experimental Eye Research. 186, 107706 (2019).</li><li>Allen, R. S., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=TrkB+signalling+pathway+mediates+the+protective+effects+of+exercise+in+the+diabetic+rat+retina.">TrkB signalling pathway mediates the protective effects of exercise in the diabetic rat retina.</a> European Journal of Neuroscience. 47 (10), 1254-1265 (2018).</li><li>Allen, R. S., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Retinal+deficits+precede+cognitive+and+motor+deficits+in+a+rat+model+of+type+II+diabetes.">Retinal deficits precede cognitive and motor deficits in a rat model of type II diabetes.</a> Investigative Ophthalmology &amp; Visual Science. 60 (1), 123-133 (2019).</li><li>Prusky, G. T., Harker, K. T., Douglas, R. M., Whishaw, I. Q. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Variation+in+visual+acuity+within+pigmented,+and+between+pigmented+and+albino+rat+strains.">Variation in visual acuity within pigmented, and between pigmented and albino rat strains.</a> Behavioural Brain Research. 136 (2), 339-348 (2002).</li><li>Hwang, C. K., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Circadian+rhythm+of+contrast+sensitivity+is+regulated+by+a+dopamine-neuronal+PAS-domain+protein+2-adenylyl+cyclase+1+signaling+pathway+in+retinal+ganglion+cells.">Circadian rhythm of contrast sensitivity is regulated by a dopamine-neuronal PAS-domain protein 2-adenylyl cyclase 1 signaling pathway in retinal ganglion cells.</a> Journal of Neuroscience. 33 (38), 14989-14997 (2013).</li><li>Mui, A. M., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Daily+visual+stimulation+in+the+critical+period+enhances+multiple+aspects+of+vision+through+BDNF-mediated+pathways+in+the+mouse+retina.">Daily visual stimulation in the critical period enhances multiple aspects of vision through BDNF-mediated pathways in the mouse retina.</a> PLoS One. 13 (2), 0192435 (2018).</li><li>Feola, A. J., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Menopause+exacerbates+visual+dysfunction+in+experimental+glaucoma.">Menopause exacerbates visual dysfunction in experimental glaucoma.</a> Experimental Eye Research. 186, 107706 (2019).</li><li>Allen, R. S., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Long-term+functional+and+structural+consequences+of+primary+blast+overpressure+to+the+eye.">Long-term functional and structural consequences of primary blast overpressure to the eye.</a> Journal of Neurotrauma. 35 (17), 2104-2116 (2018).</li><li>Maaswinkel, H., Li, L. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Spatio-temporal+frequency+characteristics+of+the+optomotor+response+in+zebrafish.">Spatio-temporal frequency characteristics of the optomotor response in zebrafish.</a> Vision Research. 43 (1), 21-30 (2003).</li><li>Benkner, B., Mutter, M., Ecke, G., M&#252;nch, T. A. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Characterizing+visual+performance+in+mice:+an+objective+and+automated+system+based+on+the+optokinetic+reflex.">Characterizing visual performance in mice: an objective and automated system based on the optokinetic reflex.</a> Behavioral Neuroscience. 127 (5), 788-796 (2013).</li><li>Lehmann, K., Schmidt, K. F., L&#246;wel, S. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Vision+and+visual+plasticity+in+ageing+mice.">Vision and visual plasticity in ageing mice.</a> Restorative Neurology and Neuroscience. 30, 161-178 (2012).</li><li>Leinonen, H., Tanila, H. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Vision+in+laboratory+rodents-tools+to+measure+it+and+implications+for+behavioral+research.">Vision in laboratory rodents-tools to measure it and implications for behavioral research.</a> Behavioral Brain Research. 352, 172-182 (2018).</li><li>Spielmann, M., Schr&#246;ger, E., Kotz, S. A., Pechmann, T., Bendixen, A. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Using+a+staircase+procedure+for+the+objective+measurement+of+auditory+stream+integration+and+segregation+thresholds.">Using a staircase procedure for the objective measurement of auditory stream integration and segregation thresholds.</a> Frontiers in Psychology. 4, 534 (2013).</li><li>Shi, C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Optimization+of+optomotor+response-based+visual+function+assessment+in+mice.">Optimization of optomotor response-based visual function assessment in mice.</a> Scientific Reports. 8 (1), 9708 (2018).</li><li>You, M., Yamane, T., Tomita, H., Sugano, E., Akashi, T. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=A+novel+rat+head+gaze+determination+system+based+on+optomotor+responses.">A novel rat head gaze determination system based on optomotor responses.</a> PLoS One. 12 (4), 0176633 (2017).</li><li>Whyte, A. J., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Reward-related+expectations+trigger+dendritic+spine+plasticity+in+the+mouse+ventrolateral+orbitofrontal+cortex.">Reward-related expectations trigger dendritic spine plasticity in the mouse ventrolateral orbitofrontal cortex.</a> The Journal of Neuroscience. 39 (23), 4595-4605 (2019).</li></ol>

Die Autoren haben nichts preiszugeben.

Die OMR und das Y-Labyrinth ermöglichen die nicht-invasive Beurteilung von Sehfunktions- und kognitiven Funktionsdefiziten bei Nagetieren im Laufe der Zeit. In diesem Protokoll wurde gezeigt, dass die OMR und das Y-Labyrinth visuelle und kognitive Defizite in Nagetiermodellen von Diabetes verfolgen.
Kritische Schritte im Protokoll
Die OMR
Einige wichtige Punkte, die bei der Durchführung der OMR zur Beurteilung der visue...

An erratum was issued for:&#160;<a href="https://www.jove.com/t/61806">Behavioral Assessment of Visual Function via Optomotor Response and Cognitive Function via Y-Maze in Diabetic Rats</a>. The author list was updated.
The author list was updated from:
Kaavya Gudapati*1,2, Anayesha Singh*1,3, Danielle Clarkson-Townsend1,4, Andrew J. Feola1,2, Rachael S. Allen1,2 
1Center for Visual and Neurocognitive Rehabilitation, Atlanta VA Medical Center, 
2Department of Biomedical Engineering, Georgia Institute of Technology, 
3Department of Neuroscience, Emory University, 
4Gangarosa Department of Environmental Health, Emory University 
* These authors contributed equally
to:
Kaavya Gudapati*1,2, Anayesha Singh*1,3, Danielle Clarkson-Townsend1,4, Stephen Q. Phillips1, Amber Douglass1, Andrew J. Feola1,2, Rachael S. Allen1,2 
1Center for Visual and Neurocognitive Rehabilitation, Atlanta VA Medical Center, 
2Department of Biomedical Engineering, Georgia Institute of Technology, 
3Department of Neuroscience, Emory University, 
4Gangarosa Department of Environmental Health, Emory University 
* These authors contributed equally

An erratum was issued for:&#160;<a href="https://www.jove.com/t/61806">Behavioral Assessment of Visual Function via Optomotor Response and Cognitive Function via Y-Maze in Diabetic Rats</a>. The author list was updated.

Erratum: Behavioral Assessment of Visual Function via Optomotor Response and Cognitive Function via Y-Maze in Diabetic Rats

Über 463 Millionen Menschen leben mit Diabetes, was ihn zu einer der größten globalen Krankheitsepidemien macht1. Eine der schwerwiegenden Komplikationen, die sich aus Diabetes ergeben, ist die diabetische Retinopathie (DR), eine der Hauptursachen für Blindheit bei amerikanischen Erwachsenen im erwerbsfähigen Alter2. In den nächsten 30 Jahren wird sich der Prozentsatz der Bevölkerung, der für DR gefährdet ist, voraussichtlich verdoppeln, daher ist es von entscheidender Bedeutung, neue Wege zur Diagnose von DR in seinen früheren Stadien zu finden, um die DR-Entwicklung zu verhindern und zu mildern3. DR wurde herkömmlicherweise für eine Gefäßerkrankung gehalten4,5,6. Jetzt, mit Hinweisen auf neuronale Dysfunktion und Apoptose in der Netzhaut, die der vaskulären Pathologie vorausgeht, ist DR definiert, um neuronale und vaskuläre Komponenten zu haben4,5,6,7,8,9. Eine Möglichkeit, DR zu diagnostizieren, wäre die Untersuchung neuronaler Anomalien in der Netzhaut, einem Gewebe, das anfälliger für oxidativen Stress und metabolische Belastung durch Diabetes sein kann als anderes nervenaufreibendes Gewebe10.
Ein Rückgang der kognitiven und motorischen Funktion tritt auch bei Diabetes auf und korreliert oft mit Netzhautveränderungen. Ältere Personen mit Typ-II-Diabetes zeichnen sich durch eine schlechtere kognitive Leistungsfähigkeit zu Studienbeginn aus und zeigen einen stärkeren kognitiven Verfall als Kontrollteilnehmer11. Darüber hinaus wurde die Netzhaut als Erweiterung des zentralen Nervensystems etabliert und Pathologien können sich in der Netzhaut manifestieren12. Klinisch wurde die Beziehung zwischen Netzhaut und Gehirn im Zusammenhang mit Alzheimer und anderen Krankheiten untersucht, wird aber nicht häufig mit Diabetes untersucht12,13,14,15,16. Veränderungen im Gehirn und in der Netzhaut während des Fortschreitens von Diabetes können anhand von Tiermodellen untersucht werden, einschließlich der STZ-Ratte (ein Modell für Typ-I-Diabetes, bei dem das Toxin Streptozotocin oder STZ verwendet wird, um Betazellen der Bauchspeicheldrüse zu schädigen) und der Goto-Kakizaki-Ratte (ein polygenes Modell von Typ-II-Diabetes, bei dem Tiere im Alter von etwa 3 Wochen spontan eine Hyperglykämie entwickeln). In diesem Protokoll wird eine Beschreibung für das Y-Labyrinth und die optomotorische Reaktion zur Beurteilung kognitiver und visueller Veränderungen bei diabetischen Nagetieren gegeben. Die optomotorische Reaktion (OMR) bewertet die Ortsfrequenz (ähnlich der Sehschärfe) und die Kontrastempfindlichkeit, indem sie charakteristische reflexive Kopfverfolgungsbewegungen überwacht, um die visuellen Schwellenwerte für jedes Auge zu messen17. Die Ortsfrequenz bezieht sich auf die Dicke oder Feinheit der Balken, und die Kontrastempfindlichkeit bezieht sich darauf, wie viel Kontrast zwischen den Balken und dem Hintergrund besteht (Abbildung 1E). In der Zwischenzeit testet das Y-Labyrinth das räumliche Kurzzeitgedächtnis und die explorative Funktion, die durch spontane Wechsel und Eintritte durch die Arme des Labyrinths beobachtet werden.
Beide Tests können bei wachen, nicht betäubten Tieren durchgeführt werden und haben den Vorteil, dass sie aus den angeborenen Reaktionen der Tiere Kapital schlagen, was bedeutet, dass sie kein Training benötigen. Beide sind relativ empfindlich, da sie verwendet werden können, um Defizite früh im Fortschreiten von Diabetes bei Nagetieren zu erkennen, und zuverlässig, da sie Ergebnisse liefern, die mit anderen visuellen, netztinalen oder Verhaltenstests korrelieren. Darüber hinaus kann die Verwendung der OMR und des Y-Labyrinths in Verbindung mit Tests wie Elektroretinogramm- und optischen Kohärenztomographie-Scans Informationen darüber liefern, wann sich netzhautale, strukturelle und kognitive Veränderungen relativ zueinander in Krankheitsmodellen entwickeln. Diese Untersuchungen könnten nützlich sein, um neuronale Degenerationen zu identifizieren, die aufgrund von Diabetes auftreten. Letztendlich könnte dies zu neuen diagnostischen Methoden führen, die DR in frühen Stadien der Progression effektiv identifizieren.
Die OMR- und Y-Labyrinth-Systeme, die zur Entwicklung dieses Protokolls verwendet wurden, sind in der Materialtabelle beschrieben. Frühere Forschungen zur OMR von Prusky et al.18 und zum Y-Labyrinth von Maurice et al.19 wurden als Ausgangspunkt für die Entwicklung dieses Protokolls verwendet.

<table>
	<tbody>
		<tr>
			<td>OptoMotry HD</td>
			<td>CerebralMechanics Inc.</td>
			<td></td>
			<td>OMR apparatus &#38; software</td>
		</tr>
		<tr>
			<td>Timer</td>
			<td>Thomas Scientific</td>
			<td>810029AR</td>
			<td></td>
		</tr>
		<tr>
			<td>Y-Maze apparatus</td>
			<td>San Diego Instruments</td>
			<td>7001-043</td>
			<td>Available specifically for rats</td>
		</tr>
	</tbody>
</table>

behavioral assessment of visual function via optomotor response and cognitive function via y-maze in diabetic rats

Die optomotorische Reaktion und das Y-Labyrinth sind Verhaltenstests, die zur Beurteilung der visuellen bzw. kognitiven Funktion nützlich sind. Die optomotorische Reaktion ist ein wertvolles Werkzeug, um Veränderungen der Räumlichen Frequenz (SF) und kontrastempfindlichen (CS) Schwellenwerte im Laufe der Zeit in einer Reihe von Netzhauterkrankungsmodellen, einschließlich diabetischer Retinopathie, zu verfolgen. In ähnlicher Weise kann das Y-Labyrinth verwendet werden, um die räumliche Kognition (gemessen durch spontane Abwechslung) und das explorative Verhalten (gemessen an einer Reihe von Einträgen) in einer Reihe von Krankheitsmodellen zu überwachen, die das zentrale Nervensystem betreffen. Zu den Vorteilen der optomotorischen Reaktion und des Y-Labyrinths gehören Empfindlichkeit, Testgeschwindigkeit, die Verwendung angeborener Reaktionen (Training ist nicht erforderlich) und die Fähigkeit, an wachen (nicht betäubten) Tieren durchgeführt zu werden. Hier werden Protokolle sowohl für die optomotorische Reaktion als auch für das Y-Labyrinth beschrieben und Beispiele für ihre Verwendung in Modellen von Typ-I- und Typ-II-Diabetes gezeigt. Zu den Methoden gehören die Vorbereitung von Nagetieren und Ausrüstung, die Leistung der optomotorischen Reaktion und des Y-Labyrinths sowie die Datenanalyse nach dem Test.

Die OMR gilt als erfolgreich, wenn von einem Nagetier Räumliche Frequenz- und Kontrastempfindlichkeitsschwellenwerte erhalten werden können. Hier wird die Verwendung der OMR zur Beurteilung der Ortsfrequenz bei naiven Kontroll-Brown-Norway- und Long-Evans-Ratten veranschaulicht, beide jung (3–6 Monate) und gealtert (9–12 Monate). Braun-Norwegen-Ratten zeigen typischerweise eine höhere Ausgangs-Ortsfrequenz als Long-Evans-Ratten. Zusätzlich wurde bei den Long-Evans-Ratten ein Alterungseffekt auf die Ortsfrequenz b...

Watch this Scientific Journal Video about Behavioral Assessment of Visual Function via Optomotor Response and Cognitive Function via Y-Maze in Diabetic Rats at JoVE.com

Behavioral Assessment of Visual Function via Optomotor Response and Cognitive Function via Y-Maze in Diabetic Rats

Neuronale Degeneration in Augen und Gehirn als Folge von Diabetes kann durch Verhaltenstests an Nagetieren beobachtet werden. Das Y-Labyrinth, ein Maß für die räumliche Kognition, und die optomotorische Reaktion, ein Maß für die visuelle Funktion, geben beide Einblick in mögliche Diagnosen und Behandlungen.

Verhaltensbewertung der visuellen Funktion über optomotorische Reaktion und kognitive Funktion über Y-Maze bei diabetischen Ratten

The optomotor response and the Y-maze are behavioral tests useful for assessing visual and cognitive function, respectively. The optomotor response is a ...

behavioral-assessment-visual-function-via-optomotor-response

Research

JoVE Journal

Behavior

5.4K Aufrufe.  Atlanta VA Medical Center. Neuronale Degeneration in Augen und Gehirn als Folge von Diabetes kann durch Verhaltenstests an Nagetieren beobachtet werden. Das Y-Labyrinth, ein Maß für die räumliche Kognition, und die optomotorische Reaktion, ein Maß für die visuelle Funktion, geben beide Einblick in mögliche Diagnosen und Behandlungen.

Serie: Behavioral Assessment of Visual Function via Optomotor Response and Cognitive Function via Y-Maze in Diabetic Rats

Assessment of Sensorimotor Function in Mouse Models of Parkinson's Disease

Sensitive and reliable behavioral outcome measures are essential to the evaluation of potential therapeutic treatments in preclinical trials for many neurodegenerative diseases. In Parkinson's disease, sensorimotor tests sensitive to varying degrees of nigrostriatal dysfunction are fundamental for testing the efficacy of potential therapeutics. Reliable and quite elegant sensorimotor measures exist for rats, however many of these tests measure sensorimotor asymmetry within the rat and are not entirely suitable for the newer genetic mouse models of PD. We have put together a battery of sensorimotor tests inspired by the sensitive tests in rats and adapted for mice. The test battery highlighted in this study is chosen for a) its sensitivity in a wide variety of mouse models of PD, b) its ease in implementing into a study, and c) its low expense. These tests have proven useful in characterizing novel genetic mouse models of PD as well as in testing potential disease-modifying therapies.

Assessment of Sensorimotor Function in Mouse Models of Parkinson&#039;s Disease

In Parkinson's disease and movement disorders in general, sensitive and reliable behavioral assays are essential for testing novel potential therapeutics. Here, we describe a manageable battery of sensorimotor tests for mice that are sensitive to varying degrees of injury to the nigrostriatal system and useful for preclinical studies.

Beurteilung der Sensomotorik in Maus-Modellen der Parkinson-Krankheit

Sensitive and  reliable behavioral outcome measures are essential to the evaluation of  potential therapeutic treatments in preclinical trials for many  ...

Forschung

Verhalten

The Crossmodal Congruency Task as a Means to Obtain an Objective Behavioral Measure in the Rubber Hand Illusion Paradigm

The rubber hand illusion (RHI) is a popular experimental paradigm. Participants view touch on an artificial rubber hand while the participants' own hidden hand is touched. If the viewed and felt touches are given at the same time then this is sufficient to induce the compelling experience that the rubber hand is one's own hand. The RHI can be used to investigate exactly how the brain constructs distinct body representations for one's own body. Such representations are crucial for successful interactions with the external world. To obtain a subjective measure of the RHI, researchers typically ask participants to rate statements such as "I felt as if the rubber hand were my hand". Here we demonstrate how the crossmodal congruency task can be used to obtain an objective behavioral measure within this paradigm.
The variant of the crossmodal congruency task we employ involves the presentation of tactile targets and visual distractors. Targets and distractors are spatially congruent (i.e. same finger) on some trials and incongruent (i.e. different finger) on others. The difference in performance between incongruent and congruent trials - the crossmodal congruency effect (CCE) - indexes multisensory interactions. Importantly, the CCE is modulated both by viewing a hand as well as the synchrony of viewed and felt touch which are both crucial factors for the RHI.
The use of the crossmodal congruency task within the RHI paradigm has several advantages. It is a simple behavioral measure which can be repeated many times and which can be obtained during the illusion while participants view the artificial hand. Furthermore, this measure is not susceptible to observer and experimenter biases. The combination of the RHI paradigm with the crossmodal congruency task allows in particular for the investigation of multisensory processes which are critical for modulations of body representations as in the RHI.

We demonstrate how an objective measure can be employed in the widely employed rubber hand illusion paradigm. This measure is obtained by modifying the well-established crossmodal congruency task. This task allows the investigation of multisensory processes which are critical for modulations of body representations as in the rubber hand illusion.

Die Kongruenz Crossmodale Aufgabe als ein Mittel zum Ziel Behavioral Messen in der Rubber Hand Illusion Paradigm erhalten

The rubber hand illusion (RHI) is a popular experimental paradigm. Participants view touch on an artificial rubber hand while the participants' own hidden ...

Irrelevant Stimuli and Action Control: Analyzing the Influence of Ignored Stimuli via the Distractor-Response Binding Paradigm

Selection tasks in which simple stimuli (e.g. letters) are presented and a target stimulus has to be selected against one or more distractor stimuli are frequently used in the research on human action control. One important question in these settings is how distractor stimuli, competing with the target stimulus for a response, influence actions. The distractor-response binding paradigm can be used to investigate this influence. It is particular useful to separately analyze response retrieval and distractor inhibition effects. Computer-based experiments are used to collect the data (reaction times and error rates). In a number of sequentially presented pairs of stimulus arrays (prime-probe design), participants respond to targets while ignoring distractor stimuli. Importantly, the factors response relation in the arrays of each pair (repetition vs. change) and distractor relation (repetition vs. change) are varied orthogonally. The repetition of the same distractor then has a different effect depending on response relation (repetition vs. change) between arrays. This result pattern can be explained by response retrieval due to distractor repetition. In addition, distractor inhibition effects are indicated by a general advantage due to distractor repetition. The described paradigm has proven useful to determine relevant parameters for response retrieval effects on human action.

The distractor-response binding paradigm is described. It can be used to shed light on the influence irrelevant stimuli, competing with targets for a response, can have on human action. Both response retrieval effects and distractor inhibition effects can be analyzed within the paradigm.

Irrelevante Reize und Aktionssteuerung: Analyse der Einfluss von Stimuli ignoriert über die Distraktor-Response-Paradigma-Bindung

Selection tasks in which simple stimuli (e.g. letters) are presented and a target stimulus has to be selected against one or more distractor stimuli are ...

A Procedure to Observe Context-induced Renewal of Pavlovian-conditioned Alcohol-seeking Behavior in Rats

Environmental contexts in which drugs of abuse are consumed can trigger craving, a subjective Pavlovian-conditioned response that can facilitate drug-seeking behavior and prompt relapse in abstinent drug users. We have developed a procedure to study the behavioral and neural processes that mediate the impact of context on alcohol-seeking behavior in rats. Following acclimation to the taste and pharmacological effects of 15% ethanol in the home cage, male Long-Evans rats receive Pavlovian discrimination training (PDT) in conditioning chambers. In each daily (Mon-Fri) PDT session, 16 trials each of two different 10 sec auditory conditioned stimuli occur. During one stimulus, the CS+, 0.2 ml of 15% ethanol is delivered into a fluid port for oral consumption. The second stimulus, the CS-, is not paired with ethanol. Across sessions, entries into the fluid port during the CS+ increase, whereas entries during the CS- stabilize at a lower level, indicating that a predictive association between the CS+ and ethanol is acquired. During PDT each chamber is equipped with a specific configuration of visual, olfactory and tactile contextual stimuli. Following PDT, extinction training is conducted in the same chamber that is now equipped with a different configuration of contextual stimuli. The CS+ and CS- are presented as before, but ethanol is withheld, which causes a gradual decline in port entries during the CS+. At test, rats are placed back into the PDT context and presented with the CS+ and CS- as before, but without ethanol. This manipulation triggers a robust and selective increase in the number of port entries made during the alcohol predictive CS+, with no change in responding during the CS-. This effect, referred to as context-induced renewal, illustrates the powerful capacity of contexts associated with alcohol consumption to stimulate alcohol-seeking behavior in response to Pavlovian alcohol cues.

A procedure to study the capacity of an alcohol associated environmental context to trigger the renewal of alcohol-seeking behavior in rats is described.

Eine Vorgehensweise, um Context-induzierte Erneuerung der Pawlowschen Anlage Alkoholsucht bei Ratten Verhalten beobachten

Environmental contexts in which drugs of abuse are consumed can trigger craving, a subjective Pavlovian-conditioned response that can facilitate ...

The Knob Supination Task: A Semi-automated Method for Assessing Forelimb Function in Rats

Tasks that accurately measure dexterity in animal models are critical to understand hand function. Current rat behavioral tasks that measure dexterity largely use video analysis of reaching or food manipulation. While these tasks are easy to implement and are robust across disease models, they are subjective and laborious for the experimenter. Automating traditional tasks or creating new automated tasks can make the tasks more efficient, objective, and quantitative. Since rats are less dexterous than primates, central nervous system (CNS) injury produces more subtle deficits in dexterity, however, supination is highly affected in rodents and crucial to hand function in primates. Therefore, we designed a semi-automated task that measures forelimb supination in rats. Rats are trained to reach and grasp a knob-shaped manipulandum and turn the manipulandum in supination to receive a reward. Rats can acquire the skill within 20 &plusmn; 5 days. While the early part of training is highly supervised, much of the training is done without direct supervision. The task reliably and reproducibly captures subtle deficits after injury and shows functional recovery that accurately reflects clinical recovery curves. Analysis of data is performed by specialized software through a graphical user interface that is designed to be intuitive. We also give solutions to common problems encountered during training, and show that minor corrections to behavior early in training produce reliable acquisition of supination. Thus, the knob supination task provides efficient and quantitative evaluation of a critical movement for dexterity in rats.

This manuscript describes a semi-automated task that quantifies supination in rats. Rats reach, grasp, and supinate a spherical manipulandum. The rat is rewarded with a pellet if the turn angle exceeds a criterion set by the user. This task increases throughput, sensitivity to injury, and objectivity compared to traditional tasks.

Drehknopf Supination Aufgabe: Eine halbautomatische Methode für die Beurteilung der Funktion der Vordergliedmaße bei Ratten

Tasks that accurately measure dexterity in animal models are critical to understand hand function. Current rat behavioral tasks that measure dexterity ...

Simultaneous Recordings of Cortical Local Field Potentials and Electrocorticograms in Response to Nociceptive Laser Stimuli from Freely Moving Rats

Electrocortical responses, elicited by laser heat pulses that selectively activate nociceptive free nerve endings, are widely used in many animal and human studies to investigate the cortical processing of nociceptive information. These laser-evoked brain potentials (LEPs) consist of several transient responses that are time-locked to the onset of laser stimuli. However, the functional properties of the LEP responses are still largely unknown, due to the lack of a sampling technique that can simultaneously record neural activities at the surface of the cortex (i.e., electrocorticogram [ECoG] and scalp electroencephalogram [scalp EEG]) and inside the brain (i.e., local field potential [LFP]). To address this issue, we present here an animal protocol using freely moving rats. This protocol is composed of three main procedures: (1) animal preparation and surgical procedures, (2) a simultaneous recording of ECoG and LFP in response to nociceptive laser stimuli, and (3) data analysis and feature extraction. Specifically, with the help of a 3D-printed protective shell, both ECoG and LFP electrodes implanted on the rat&#39;s skull were securely held together. During data collection, laser pulses were delivered on the rat&#39;s forepaws through gaps in the bottom of the chamber when the animal was in spontaneous stillness. Ongoing white noise was played to avoid the activation of the auditory system by the laser-generated ultrasounds. As a consequence, only nociceptive responses were selectively recorded. Using the standard analytical procedures (e.g., band-pass filtering, epoch extraction, and baseline correction) to extract stimulus-related brain responses, we obtained results showing that LEPs with a high signal-to-noise ratio were simultaneously recorded from ECoG and LFP electrodes. This methodology makes the simultaneous recording of ECoG and LFP activities possible, which provides a bridge of electrocortical signals at the mesoscopic and macroscopic levels, thereby facilitating the investigation of nociceptive information processing in the brain.

We developed a technique that simultaneously records both electrocorticography and local field potentials in response to nociceptive laser stimuli from freely moving rats. This technique helps establish a direct relationship of electrocortical signals at the mesoscopic and macroscopic levels, which facilitates the investigation of nociceptive information processing in the brain.

Gleichzeitige Aufnahmen von kortikalen lokales Feld Potentialen und Electrocorticograms in Reaktion auf Reize der nozizeptiven Laser von frei beweglichen Ratten

Electrocortical responses, elicited by laser heat pulses that selectively activate nociceptive free nerve endings, are widely used in many animal and ...

Supramaximal Intensity Hypoxic Exercise and Vascular Function Assessment in Mice

Exercise training is an important strategy for maintaining health and preventing many chronic diseases. It is the first line of treatment recommended by international guidelines for patients suffering from cardiovascular diseases, more specifically, lower extremity artery diseases, where the patients' walking capacity is considerably altered, affecting their quality of life. 
Traditionally, both low continuous exercise and interval training have been used. Recently, supramaximal training has also been shown to improve athletes' performances via vascular adaptations, amongst other mechanisms. The combination of this type of training with hypoxia could bring an additional and/or synergic effect, which could be of interest for certain pathologies. Here, we describe how to perform supramaximal intensity training sessions in hypoxia on healthy mice at 150% of their maximal speed, using a motorized treadmill and a hypoxic box. We also show how to dissect the mouse in order to retrieve organs of interest, particularly the pulmonary artery, the abdominal aorta, and the iliac artery. Finally, we show how to perform ex vivo vascular function assessment on the retrieved vessels, using isometric tension studies.

High-intensity training in hypoxia is a protocol that has been proven to induce vascular adaptations potentially beneficial in some patients and to improve athletes&#39; repeated sprint ability. Here, we test the feasibility of training mice using that protocol and identify those vascular adaptations using ex vivo vascular function assessment.

Supramaximalen hypoxischer Intensität und Gefäßfunktion Bewertung bei Mäusen

Exercise training is an important strategy for maintaining health and preventing many chronic diseases. It is the first line of treatment recommended by ...

Investigating the Deployment of Visual Attention Before Accurate and Averaging Saccades via Eye Tracking and Assessment of Visual Sensitivity

This experimental protocol was designed to investigate whether visual attention is obligatorily deployed at the endpoint of saccades. To this end, we recorded the eye position of human participants engaged in a saccade task via eye tracking and assessed visual orientation discrimination performance at various locations during saccade preparation. Importantly, instead of using a single saccade target paradigm for which the saccade endpoint typically coincides roughly with the target, this protocol comprised the presentation of two nearby saccade targets, leading to a distinct spatial dissociation between target locations and saccade endpoint on a substantial number of trials. The paradigm allowed us to compare presaccadic visual discrimination performance at the endpoint of accurate saccades (landing at one of the saccade targets) and of averaging saccades (landing at an intermediate location in between the two targets). We observed a selective enhancement of visual sensitivity at the endpoint of accurate saccades but not at the endpoint of averaging saccades. Rather, before the execution of averaging saccades, visual sensitivity was equally enhanced at both targets, suggesting that saccade averaging follows from unresolved attentional selection among the saccade targets. These results argue against a mandatory coupling between visual attention and saccade programming based on a direct measure of presaccadic visual sensitivity rather than saccadic reaction times, which have been used in other protocols to draw similar conclusions. While our protocol provides a useful framework to investigate the relationship between visual attention and saccadic eye movements at the behavioral level, it can also be combined with electrophysiological measures to extend insights at the neuronal level.

This experimental protocol combined eye tracking and the assessment of presaccadic visual sensitivity in a dual task paradigm, consisting of a free choice saccade task and a visual discrimination task, to investigate the deployment of visual spatial attention before both, accurate and averaging saccades.

Die Bereitstellung der visuellen Aufmerksamkeit vor genau und durchschnittlich Sakkaden über Eye-Tracking und Bewertung der visuelle Empfindlichkeit zu untersuchen

This experimental protocol was designed to investigate whether visual attention is obligatorily deployed at the endpoint of saccades. To this end, we ...

Integrating Visual Psychophysical Assays within a Y-Maze to Isolate the Role that Visual Features Play in Navigational Decisions

Collective animal behavior arises from individual motivations and social interactions that are critical for individual fitness. Fish have long inspired investigations into collective motion, specifically, their ability to integrate environmental and social information across ecological contexts. This demonstration illustrates techniques used for quantifying behavioral responses of fish, in this case, Golden Shiner (Notemigonus crysoleucas), to visual stimuli using computer visualization and digital image analysis. Recent advancements in computer visualization allow for empirical testing in the lab where visual features can be controlled and finely manipulated to isolate the mechanisms of social interactions. The purpose of this method is to isolate visual features that can influence the directional decisions of the individual, whether solitary or with groups. This protocol provides specifics on the physical Y-maze domain, recording equipment, settings and calibrations of the projector and animation, experimental steps and data analyses. These techniques demonstrate that computer animation can elicit biologically-meaningful responses. Moreover, the techniques are easily adaptable to test alternative hypotheses, domains, and species for a broad range of experimental applications. The use of virtual stimuli allows for the reduction and replacement of the number of live animals required, and consequently reduces laboratory overhead.
This demonstration tests the hypothesis that small relative differences in the movement speeds (2 body lengths per second) of virtual conspecifics will improve the speed and accuracy with which shiners follow the directional cues provided by the virtual silhouettes. Results show that shiners directional decisions are significantly affected by increases in the speed of the visual cues, even in the presence of background noise (67% image coherency). In the absence of any motion cues, subjects chose their directions at random. The relationship between decision speed and cue speed was variable and increases in cue speed had a modestly disproportionate influence on directional accuracy.

Here, we present a protocol to demonstrate a behavioral assay that quantifies how alternative visual features, such as motion cues, influence directional decisions in fish. Representative data are presented on the speed and accuracy where Golden Shiner (Notemigonus crysoleucas) follow virtual fish movements.

Integration visueller psychophysischer Assays in ein Y-Maze, um die Rolle zu isolieren, die visuelle Features bei Navigationsentscheidungen spielen

Collective animal behavior arises from individual motivations and social interactions that are critical for individual fitness. Fish have long inspired ...

Dynamic Digital Biomarkers of Motor and Cognitive Function in Parkinson's Disease

As Parkinson&#8217;s disease (PD) is a heterogeneous disorder, personalized medicine is truly required to optimize care. In their current form, standard scores from paper and pencil symptom- measures traditionally used to track disease progression are too coarse (discrete) to capture the granularity of the clinical phenomena under consideration, in the face of tremendous symptom diversity. For this reason, sensors, wearables, and mobile devices are increasingly incorporated into PD research and routine care. These digital measures, while more precise, yield data that are less standardized and interpretable than traditional measures, and consequently, the two types of data remain largely siloed. Both of these issues present barriers to the broad clinical application of the field&#8217;s most precise assessment tools. This protocol addresses both problems. Using traditional tasks to measure cognition and motor control, we test the participant, while co-registering biophysical signals unobtrusively using wearables. We then integrate the scores from traditional paper-and-pencil methods with the digital data that we continuously register. We offer a new standardized data type and unifying statistical platform that enables the dynamic tracking of change in the person&#8217;s stochastic signatures under different conditions that probe different functional levels of neuromotor control, ranging from voluntary to autonomic. The protocol and standardized statistical framework offer dynamic digital biomarkers of physical and cognitive function in PD that correspond to validated clinical scales, while significantly improving their precision.&#160;

This protocol offers a digitization of portions of traditional clinical tasks commonly used to measure cognition and motor control in Parkinson&#8217;s disease. Clinical tasks are digitized while biophysical rhythms are co-registered from different functional levels of the nervous systems, ranging from voluntary, spontaneous, automatic to autonomic.

Dynamische digitale Biomarker der motorischen und kognitiven Funktion bei Parkinson

As Parkinson&#8217;s disease (PD) is a heterogeneous disorder, personalized medicine is truly required to optimize care. In their current form, standard ...