The authors would like to acknowledge Natalie Doude and David Westerway (University of Alberta) for providing us Sho cDNA, Christophe Chevalier (INRA) for plasmid construction, Michel Br&#233;mont (INRA) for providing us BL21Sol bacteria; Christine Longin (INRA) for TEM assistance and Edith Pajot-Augy (INRA) for comments and proofreading.

1. Erzeugung von Plasmid und Expression Shadoo Hinweis: Das Gen, das murine Shadoo Protein (Shadoo 25-122), wurde in den Expressionsvektor pET-28 11 subkloniert. Dieser Klon wurde in den E. transformierten coli SoluBL21 Bakterienstamm, um Shadoo Protein mit einem N-terminalen Hexahistidin-Tag, (HHHHHHHHHHSSGHIDDDDKHMKGGRGGARGSARGVRGGARGASRVRVRP APRYGSSLRVAAAGAAAGAAAGVAAGLATGSGWRRTSGPGELGLEDDENGAMGGNGTDRGVYSYWAWTSG) zum Ausdruck bringen, wie zuvor 11 erläutert. Das Plasmid kann von den Autoren angefragt werden. Das Molekulargewicht des Shadoo aus seiner Aminosäuresequenz berechneten 12,243.2 Da. Hinweis: Führen Sie alle Manipulationen mit Bakterien unter dem laminal Flow-Haube oder in der Nähe Bunsenflamme. <ol><li> Transformieren kompetenter SoluBL21 Bakterien mit dem pET-28-His 6 -Shadoo Plasmid, mit einem Standard-Hitzeschockprotokoll. Für diese Mischung 1 bis 5 &amp; mgr; l der Plasmid (typischerweise 10 bis 100 pgng) in 50 &amp; mgr; l der Bakterien in einem Rohr. Führen Sie den Hitzeschock bei 42 ° C für 45 sec. </li><li> Kultur transformierter Bakterien bei 37 ° C, bis ein 600 0,5-0,7 in Luria-Bertani-Medium mit 40 mg / ml Kanamycin (1B) ergänzt. </li><li> Induzieren Shadoo Expression O / N durch Zugabe von 240 &amp; mgr; g / ml Isopropyl-β-D-thiogalactopyranosid, ITPG, zu der Kultur. Kultur des Bakteriums unter Schütteln bei 150 Upm bei 37 ° C. Anmerkung: In der Regel reicht von 3 A 600 O / N-Bakterienkultur. Anmerkung: Die transformierten Bakterien können bei -80 ° C für zukünftige Proteinproduktion gespeichert werden. Dazu fügen Sie 10% -50% (v / v) steriles Glycerin in Bakterienkultur Aliquots und frieren Sie sie bei -80 ° C. </li></ol><img alt="Abbildung 1" src="/files/ftp_upload/53432/53432fig1.jpg" /> Abbildung 1. Schema der Shadoo Expressionskonstrukt, Bakterien Transformation und Induktion von Shadoo Ausdruck (wie in Schritt 1 beschrieben). </strong&gt; (A) Das Expressionskonstrukt für Shadoo codiert ein Hexahistidin-Tag an den N-Terminus des Proteins, Nt fusioniert. Das Schema zeigt, dass Shadoo Protein enthält grundlegende Arginin / Glycin-Repeats (grünen Zylinder), eine hydrophobe Domäne (HD) und eine einzige N-Glykosylierungsstelle (CHO), gefolgt von einem C-Terminus (Ct). (B) pET-28-His 6 -Shadoo Plasmid in SoluBL21 Bakterien durch Hitzeschock für 45 Sekunden bei 42 ° C umgesetzt. Transformierten Bakterien werden auf selektivem Agar, der 40 ug / ml Kanamycin ausplattiert. Eine einzelne Kolonie von der Platte verwendet, um eine Kultur in einem 1000-3000 ml-Schüttelkolben zu inokulieren. Die Expression des rekombinanten Proteins ist mit 1 mM IPTG induziert. <a href="https://www.jove.com/files/ftp_upload/53432/53432fig1highres.jpg" target="_blank">Bitte klicken Sie hier, um eine größere Version dieser Figur zu sehen.</a> 2. Reinigung von Shadoo Protein durch Niederdruck-Flüssigchromatographie (LPLC) <ol><li> Zell-Lyse und Inschluss Gremien Vorbereitung <ol><li> Sammeln Sie die Bakteriensuspension und übertragen sie in Zentrifugenröhrchen (Abbildung 2). </li><li> Schleudern bei 2.500 xg für 20 min bei 4 ° C. Überstand durch Dekantieren zu entfernen und resuspendieren Pellets in 15 ml Puffer (50 mM Tris, 10 mM EDTA, pH 8 mit Anti-Protease-Cocktail) für jeden Pellets aus 500 ml Zellkultur abgeleitet ist. Anmerkung: Die resuspendierten Pellets können eingefroren und bei -20 ° C für mehrere Tage gelagert werden. Freezing erleichtert Bakterienzellen-Lyse. </li><li> Überprüfen Sie die Überexpression des rekombinanten Proteins mit rohen Bakterien Pellets durch SDS-PAGE-Analyse und Coomassie-Färbung. <ol><li> Hierzu Zentrifugen 1 ml Bakterienkultur pelleZellen. 100 ul Laemmli Denaturierungslösung (277,8 mM Tris-HCl, pH 6,8, 4,4% SDS, 44,4% w / v Glycerol, 0,02% Bromphenolblau) pelletiert und Wärme bei 100 ° C für 5 min. </li><li> Last 10 ul der Probe auf einem 12% Acrylamidgel laufen SDS-PAGE und visualize getrennten Proteine ​​durch Coomassie-Färbung. </li></ol></li><li> Hinzufügen Triton X-100 auf 0,5% Endkonzentration in die vollständig resuspendierten Pellets 2.1.2). </li><li> Inkubieren der Suspension in einem Wasserbad bei 37 ° C für 30 min. </li><li> Beschallen der Suspension für 5 min bei 6-12 &amp; mgr; m Spitze-zu-Spitze-Amplitude in eiskaltem Wasser, um bakterielle Zellen zu lysieren. </li><li> Transfer beschallte Suspension in sauberen 50 ml Zentrifugenröhrchen. </li><li> Zentrifugenröhrchen bei 15.000 xg für 15 min bei 4 ° C. </li><li> Überstand entfernen durch Dekantieren und 5 ml des Bindungspuffers (20 mM Tris-HCl-Puffer, pH 7,4, 0,5 M NaCl, 8 M Harnstoff, 5 mM Imidazol) pro Röhrchen. </li><li> Die Röhrchen auf dem sich drehenden Rad O / N komplett resuspendieren Proteine ​​aus Einschlusskörpern. </li></ol><img alt="Figur 2" src="/files/ftp_upload/53432/53432fig2.jpg" /> Abbildung 2. Schema der Reinigung von EinschlussKörpern (wie in Schritt 2.1 beschrieben). Die transformierten Bakterien exprimiert Shadoo werden durch Zentrifugation geerntet und in Lysepuffer resuspendiert. Die Suspension wird bei 37 ° C für 30 min inkubiert und dann beschallt, um Bakterienzellen mechanisch zu brechen. Beschallung auf Eis durchgeführt, um Probenerwärmung zu verhindern. Gebrochenen Zellen werden durch Zentrifugation geerntet und in einem Puffer, der 8 M Harnstoff, um Proteine ​​aus Einschlusskörper solubilisiert resuspendiert. <a href="https://www.jove.com/files/ftp_upload/53432/53432fig2highres.jpg" target="_blank">Bitte klicken Sie hier, um eine größere Version dieser Figur zu sehen.</a> </li><li> Ni 2+ -Affinitätschromatographie Anmerkung: Die Chromatographie an FPLC-System unter Verwendung einer Ni 2+ -charged, 5 ml Sepharose chelatbildende Säule (3A) durchgeführt. Alle Lösungen werden auf die Säule mit einer Fließgeschwindigkeit von 1 ml / min geladen. <ol><li> Injizieren von 10 ml 0,2 M NiSO 4 Wasserlösung in die Säule Sepharose, um sie aufzuladenmit Ni 2+ -Ionen. </li><li> Äquilibrieren der Säule mit Ni 2+ -Ionen geladenen durch Injektion von 30-50 ml des Bindungspuffers, der eine niedrige Konzentration an Imidazol (20 mM Tris-HCl-Puffer, pH 7,4, 0,5 M NaCl, 8 M Harnstoff, 5 mM Imidazol). </li><li> Laden Sie die Harnstoff solubilisiert Proteine ​​mit einer 50 ml Injektionsschleife. </li><li> Wiederherstellung der Durchflussfraktion durch gründliches Waschen der Säule mit 10 ml niedrig Imidazol Bindungspuffer (20 mM Tris-HCl-Puffer, pH 7,4, 0,5 M NaCl, 8 M Harnstoff, 5 mM Imidazol), um ein Maximum von ungebundenen Proteine ​​zu entfernen von der Säule. </li><li> Mit 50-100 ml des Waschpuffers (20 mM Tris-HCl, pH 7,4, 0,5 M NaCl, 8 M Harnstoff, 80 mM Imidazol), Proteine ​​unspezifisch an die Säule gebunden eluieren Die Säule wird. </li><li> Anwenden eines 15 min Gradienten von 80-800 linearen mM Imidazol in Puffer, der 20 mM Tris-HCl, pH 7,4, 0,5 M NaCl, 8 M Harnstoff. Sammeln Sie 1-ml-Fraktionen während der Gradienten-Anwendung. Hinweis: His-Tag-Proteine ​​eluiert witha Gradienten von Imidazol enthaltenden Puffer (als Konkurrent verwendet). </li><li> Werfen Sie einen 8-ul-Aliquot jeder Fraktion und fügen Sie 4 ul 4x Laemmli Denaturierungslösung (siehe 2.1.3.1). Hitzelösungen bei 100 ° C für 5 min. </li><li> Last 10 ul Proteingrößenmarker und 10 ul jeder Probe auf den 12% igen Acrylamidgel laufen SDS-PAGE und sichtbar getrennten Proteine ​​durch Coomassie-Färbung. Hinweis: Das Molekulargewicht Shadoo berechnet bilden seine Aminosäuresequenz ist 12,243.2 Da. </li><li> Pool alle Fraktionen, die Shadoo. </li></ol><img alt="Figur 3" src="/files/ftp_upload/53432/53432fig3.jpg" /> Abbildung 3. Reinigungsverfahren (wie in den Schritten 2.2-2.4 beschrieben). (A) Ni 2+ -Ionen durch Histidinreste, die die selektive Reinigung von Polyhistidin-markierte Proteine ​​können koordiniert werden. Imidazol wird verwendet, um das Protein zu eluieren, durchseine Fähigkeit, mit der Ni 2+ -Ionen koordinieren und verdrängen das gebundene Protein. (B) Proteine ​​mit unterschiedlichen hydrodynamischen Radius, der auf der Ni 2+ -Säule auf einer Größenausschluss-Säule zurückgehalten wurden. Proteine ​​werden von der größten bis zur kleinsten, eluiert. (C) Vor dem Gebrauch enthaltenden Fraktionen werden vereinigt und Shadoo entsalzt Harnstoff, Imidazol und Salze zu entfernen. Qualitätskontrolle Tests umfassen SDS-PAGE / Coomassie-Färbung, Western-Blot. Gereinigtes Shadoo kann gefriergetrocknet werden. Lyophilisierte Shadoo ist über Monate stabil, wenn sie bei -20 ° C gelagert. <a href="https://www.jove.com/files/ftp_upload/53432/53432fig3highres.jpg" target="_blank">Bitte klicken Sie hier, um eine größere Version dieser Figur zu sehen.</a> </li><li> Größenausschlusschromatographie Hinweis: Eine zweite Reinigungsschritt besteht in der Größenausschluß-Chromatographie, die Shadoo Proteins von anderen Proteinen in der ersten Reinigungsstufe coeluierte trennt(3B). <ol><li> Äquilibrieren Superdex-Säule von 120 ml gesamten Bettvolumens durch die Injektion 250 ml 20 mM Tris-HCl-Puffer, pH 7,4, 0,5 M NaCl, 8 M Harnstoff mit einer Fließgeschwindigkeit von 1,5 ml / min. </li><li> Last vereinigten Fraktionen, Shadoo von 2.2.9 auf die äquilibrierte Säule. Sammeln 1 ml-Fraktionen nach der Säule-Hohlraumvolumen von 40 ml auf die konstante Strömung des obigen Puffers. </li><li> Nehmen Sie ein 10 ul-Aliquot jeder Fraktion und führen Sie eine SDS-PAGE-Analyse und Coomassie-Färbung wie oben beschrieben, um herauszufinden, welche Fraktionen enthalten Shadoo. </li><li> Pool Fraktionen, Shadoo. </li></ol></li><li> Entsalzung Anmerkung: Entsalzungsverfahren entfernt Salze, Imidazol und Harnstoff rekombinante Shadoo Protein in einer für die weitere biophysikalische und biochemische Untersuchungen (3C) Puffer erhalten. Das gleiche Ergebnis kann durch Dialysieren Proben gegen den Puffer erhalten werden. <ol><li> Äquilibrieren eine Entsalzungssäule von 53 ml mit 150 mlvon 10 mM Ammoniumacetat-Puffer, pH 5, mit einer Fließgeschwindigkeit von 5 ml / min. </li><li> Last gepoolt Shadoo Fraktionen auf die Säule. Bei Injektion des Ammoniumacetatpuffer sammeln manuell Fraktionen, die eine Erhöhung des Signals bei 280 nm am Ausgang des UV-Detektors zeigen. </li><li> Gefrierzutrocknen der entsalzten Shadoo und speichern Sie sie bei -20 ° C. </li><li> Aufzulösen lyophilisierten Shadoo in ausreichender Puffer, wie 10 mM Natriumacetatpuffer, pH 5, vor der Verwendung. Hinweis: Die Polyhistidin-Tag kann mit Enterokinase entfernt werden. </li></ol></li></ol> 3. In-vitro-Montage von Shadoo in Amyloidfibrillen bei physiologischen pH- Hinweis: Die Shadoo Proteinaggregate und Fibrillen bildet spontan bei pH ≥ 7 11. <img alt="Figur 4" src="/files/ftp_upload/53432/53432fig4.jpg" /> Abbildung 4. Schema der Shadoo Rückfaltung an Amyloidfibrillen (wie beschrieBett im Schritt 3). Gereinigtes Shadoo wandelt spontan an Amyloidfibrillen als in Puffer pH ≥ 7, gelöst in einer sauren Lösung, wandelt Shadoo an Amyloidfibrillen bei Inkubation mit 1 M Gdn-HCl unter Schütteln. Qualitätskontrolle Tests umfassen Elektronenmikroskopie und THT-Färbung. <a href="https://www.jove.com/files/ftp_upload/53432/53432fig4highres.jpg" target="_blank">Bitte klicken Sie hier, um eine größere Version dieser Figur zu sehen.</a> <ol><li> Verdünnter Shadoo bis zu einer Endkonzentration von 2 &amp; mgr; M in 20 mM Tris-HCl-Puffer, pH 7,4. Messen der Konzentration durch Messen der optischen Dichte der Lösung bei 280 nm und unter Verwendung des Extinktionskoeffizienten von Shadoo Aminosäurezusammensetzung von 20.970 abgeleitet. </li><li> Inkubieren 500 ul der Lösung in einem konischen Kunststoffröhrchen bei 4 ° C für ein paar Wochen, um eine spontane Umwandlung Protein Amyloid-Strukturen (Figur 4) zu ermöglichen. </li><li> Hinzufügen frisch Thioflavin T (THT) bis zu einer endgültigen conce vorbereitetntration von 10 um bis 100 &amp; mgr; l Aliquot der Lösung Shadoo. Inkubieren der Lösung für 5 Minuten bei RT. Messung der Fluoreszenzemission von 460 bis 520 nm unter Verwendung einer Anregungswellenlänge von 435 nm, um das Vorhandensein von Amyloid-Strukturen 17 zu verifizieren. </li></ol> 4. In-vitro-Montage von Shadoo an Amyloidfibrillen bei sauren pH-Werten <ol><li> Verdünnter Shadoo in 1 M GdnHCl, 20 mM Na-Acetatpuffer, pH 5 zu einer Endkonzentration von 2 uM. </li><li> Inkubieren 500 ul dieser Lösung in einem konischen Röhrchen unter ständigem Schütteln bei 37 ° C für 3-7 Tage. </li><li> Prüfen Sie das Vorhandensein von Amyloidfibrillen durch Zugabe ThT zu einem aliquoten Teil der Lösung nach 3.3. </li><li> Dialyse erhaltene Suspension gegen 10 mM Na-Acetat-Puffer, pH 5,0, zu Shadoo Amyloidfibrillen zu reinigen. </li><li> Bewahren Sie gereinigte Fibrillen bei +4 ° C. </li></ol><img alt="Figur 5" src="/files/ftp_upload/53432/53432fig5.jpg"/&gt; Figur 5. Repräsentative Ergebnisse. Proteinfraktionen aus Ni 2+ eluiert -charged chelatbildende Säule (A) und Größenausschluss-Säule (B) wurden unter Verwendung von SDS-PAGE und Coomassie-Färbung analysiert. Bezeichnung des gereinigten Shadoo wurde mit SPRN Anti Shadoo Antikörper (C) bewertet. <a href="https://www.jove.com/files/ftp_upload/53432/53432fig5large.jpg" target="_blank">Bitte klicken Sie hier, um eine größere Version dieser Figur zu sehen.</a>

<ol>
	<li>Biasini, E., Turnbaugh, J. A., Unterberger, U., Harris, D. A. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Prion+protein+at+the+crossroads+of+physiology+and+disease.">Prion protein at the crossroads of physiology and disease.</a> Trends in Neurosciences. 35, 92-103 (2012).</li><li>Colby, D. W., Prusiner, S. B. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=De+novo+generation+of+prion+strains.">De novo generation of prion strains.</a> Nature Reviews. Microbiology. 9, 771-777 (2011).</li><li>Chiti, F., Dobson, C. M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Protein+misfolding,+functional+amyloid,+and+human+disease.">Protein misfolding, functional amyloid, and human disease.</a> Annual Review of Biochemistry. 75, 333-366 (2006).</li><li>Nelson, R., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Structure+of+the+cross-beta+spine+of+amyloid-like+fibrils.">Structure of the cross-beta spine of amyloid-like fibrils.</a> Nature. 435, 773-778 (2005).</li><li>Murphy, R. M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Kinetics+of+amyloid+formation+and+membrane+interaction+with+amyloidogenic+proteins.">Kinetics of amyloid formation and membrane interaction with amyloidogenic proteins.</a> Biochimica et Biophysica Acta. 1768, 1923-1934 (2007).</li><li>Steunou, S., Chich, J. F., Rezaei, H., Vidic, J. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Biosensing+of+lipid-prion+interactions:+insights+on+charge+effect,+Cu(II)-ions+binding+and+prion+oligomerization.">Biosensing of lipid-prion interactions: insights on charge effect, Cu(II)-ions binding and prion oligomerization.</a> Biosensors &amp; Bioelectronics. 26, 1399-1406 (2010).</li><li>Watts, J. C., Westaway, D. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+prion+protein+family:+diversity,+rivalry,+and+dysfunction.">The prion protein family: diversity, rivalry, and dysfunction.</a> Biochimica et Biophysica Acta. 1772, 654-672 (2007).</li><li>Westaway, D., Daude, N., Wohlgemuth, S., Harrison, P. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+PrP-like+proteins+Shadoo+and+Doppel.">The PrP-like proteins Shadoo and Doppel.</a> Topics in Current Chemistry. 305, 225-256 (2011).</li><li>Baillod, P., Garrec, J., Tavernelli, I., Rothlisberger, U. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Prion+versus+doppel+protein+misfolding:+new+insights+from+replica-exchange+molecular+dynamics+simulations.">Prion versus doppel protein misfolding: new insights from replica-exchange molecular dynamics simulations.</a> Biochemistry. 52, 8518-8526 (2013).</li><li>Daude, N., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Wild-type+Shadoo+proteins+convert+to+amyloid-like+forms+under+native+conditions.">Wild-type Shadoo proteins convert to amyloid-like forms under native conditions.</a> Journal of Neurochemistry. 113, 92-104 (2010).</li><li>Li, Q., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Shadoo+binds+lipid+membranes+and+undergoes+aggregation+and+fibrillization.">Shadoo binds lipid membranes and undergoes aggregation and fibrillization.</a> Biochemical and Biophysical Research Communications. 438, 519-525 (2013).</li><li>Watts, J. C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+CNS+glycoprotein+Shadoo+has+PrP(C)-like+protective+properties+and+displays+reduced+levels+in+prion+infections.">The CNS glycoprotein Shadoo has PrP(C)-like protective properties and displays reduced levels in prion infections.</a> The EMBO Journal. 26, 4038-4050 (2007).</li><li>Watts, J. C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Protease-resistant+prions+selectively+decrease+Shadoo+protein.">Protease-resistant prions selectively decrease Shadoo protein.</a> PLoS Pathogens. 7, e1002382 (2011).</li><li>Westaway, D., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Down-regulation+of+Shadoo+in+prion+infections+traces+a+pre-clinical+event+inversely+related+to+PrP(Sc)+accumulation.">Down-regulation of Shadoo in prion infections traces a pre-clinical event inversely related to PrP(Sc) accumulation.</a> PLoS Pathogens. 7, e1002391 (2011).</li><li>Chevalier, C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=PB1-F2+influenza+A+virus+protein+adopts+a+beta-sheet+conformation+and+forms+amyloid+fibers+in+membrane+environments.">PB1-F2 influenza A virus protein adopts a beta-sheet conformation and forms amyloid fibers in membrane environments.</a> The Journal of Biological Chemistry. 285, 13233-13243 (2010).</li><li>Tarus, B., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Oligomerization+paths+of+the+nucleoprotein+of+influenza+A+virus.">Oligomerization paths of the nucleoprotein of influenza A virus.</a> Biochimie. 94, 776-785 (2012).</li><li>Biancalana, M., Koide, S. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Molecular+mechanism+of+Thioflavin-T+binding+to+amyloid+fibrils.">Molecular mechanism of Thioflavin-T binding to amyloid fibrils.</a> Biochimica et Biophysica Acta. 1804, 1405-1412 (2010).</li><li>Minic, J., Sautel, M., Salesse, R., Pajot-Augy, E. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Yeast+system+as+a+screening+tool+for+pharmacological+assessment+of+g+protein+coupled+receptors.">Yeast system as a screening tool for pharmacological assessment of g protein coupled receptors.</a> Current Medicinal Chemistry. 12, 961-969 (2005).</li><li>Schein, C. H. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=A+cool+way+to+make+proteins.">A cool way to make proteins.</a> Nature Biotechnology. 22, 826-827 (2004).</li><li>Sorensen, H. P., Mortensen, K. K. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Advanced+genetic+strategies+for+recombinant+protein+expression+in+Escherichia+coli.">Advanced genetic strategies for recombinant protein expression in Escherichia coli.</a> Journal of Biotechnology. 115, 113-128 (2005).</li><li>Zhang, J., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Disruption+of+glycosylation+enhances+ubiquitin-mediated+proteasomal+degradation+of+Shadoo+in+Scrapie-infected+rodents+and+cultured+cells.">Disruption of glycosylation enhances ubiquitin-mediated proteasomal degradation of Shadoo in Scrapie-infected rodents and cultured cells.</a> Molecular Neurobiology. 49, 1373-1384 (2014).</li><li>Englund, P. T. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+structure+and+biosynthesis+of+glycosyl+phosphatidylinositol+protein+anchors.">The structure and biosynthesis of glycosyl phosphatidylinositol protein anchors.</a> Annual Review of Biochemistry. 62, 121-138 (1993).</li><li>Puig, B., Altmeppen, H., Glatzel, M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+GPI-anchoring+of+PrP:+implications+in+sorting+and+pathogenesis.">The GPI-anchoring of PrP: implications in sorting and pathogenesis.</a> Prion. 8, 11-18 (2014).</li></ol>

The authors have nothing to disclose.

Ein einfaches und effizientes Protokoll sowohl für die Expression und Reinigung einer großen Menge an rekombinantem Maus Shadoo Protein präsentiert. Das beschriebene Verfahren ermöglicht erfolgreiche Solubilisierung und Reinigung von (His 6) -markierte rekombinanten Shadoo Protein. Es ist wichtig, wie in dem Dokument darauf hingewiesen, dass, wenn in einem prokaryontischen Bakteriums E. ausgedrückt coli Shadoo sammelt sich in Einschlusskörpern. Vor Shadoo Reinigung haben Bakterien, dur...

Prion neurodegenerativen Erkrankungen, die bovine spongiforme Enzephalopathie bei Rindern, Scrapie bei Schafen und Creutzfeldt-Jakob-Krankheit beim Menschen, sind tödlich und unheilbar. Prion-Krankheiten durch Konformationsänderungen des zellulären Prionproteins im Wesentlichen aus α-Helices in die Quer β-Faltblatt gekennzeichnet angereichert Amyloid Konformer 1,2. Cross-β-Strukturen enthalten dicht gepackt und hochgeordnete kristalline artigen β-sheets stabilisiert mit 3,4-Wasserstoffbrücken. Prion Amyloide sich selbst replizieren aufgrund der β-Stränge an die wachsende Kante, die eine Vorlage für die Rekrutierung geben und Umwandeln eines monomeren Proteineinheit. Nach Angaben der &quot;Nur-Protein-Hypothese&quot;, die Amyloid-Konformer des Prionprotein der einzige Infektionserreger. Jedoch einige andere Biomoleküle wurden vorgeschlagen wesentlich, Prion-Erkrankungen sein. Zum Beispiel werden die Zellmembranen gedacht, ein Ort, wo conversi seinauf erfolgt und einige negativ geladene Lipide sind gezeigt worden, um die Konvertierung zu 5,6 zu erhöhen. Darüber hinaus können einige Proteine ​​auch im Prion-Erkrankungen beteiligt. Insbesondere gibt es zwei weitere Mitglieder des Prionproteinfamilie: Doppel und Shadoo 7,8. Doppel weist eine relativ steife Struktur mit Di-Sulfidbrücken stabilisiert zu werden, keine spontan polymerisieren und Aggregat an Amyloidfibrillen 9. Im Gegensatz dazu, ähnlich wie bei Prion-Protein, Shadoo eine β-Faltblatt-angereicherten Struktur und Selbstassoziation in Amyloidfibrillen Strukturen erlassen. Es konnte gezeigt werden, dass Shadoo kann unter nativen Bedingungen oder bei der Bindung negativ geladenen Membranen 10,11 fibrillieren. Umwandlung von Shadoo in amyloidartigen Fasern können mit Krankheiten in Verbindung gebracht werden. Tatsächlich sind die Mechanismen, durch die Amyloid-ähnliche Strukturen Krankheiten verursachen kaum verstanden. Shadoo trägt eine hydrophobe Domäne (HD) und eine Reihe von Tandem Arg / Gly wiederholt ähnliche to den N-terminalen Teil des Prion-Proteins (1A). Als die N-terminalen Teil des Prionproteins wird Shadoo stark positiv und scheint eine nativ unstrukturierte Protein 11,12 sein. Shadoo scheint funktionell auf Prionen-Erkrankungen sein, da es direkt binden Prionprotein. Zusätzlich ist seine Expression unten während Prion Pathologie 13,14 geregelt. Jedoch ist die Rolle von Shadoo Prionenerkrankungen noch nicht etabliert. Wir entwickelten ein Plasmid, das die codierende Sequenz der Maus Shadoo Gens. Das Plasmid wurde verwendet, um E.-Transformation coli zur Herstellung von N-terminalen His-6-Fusionsprotein Shadoo. Dieses Expressionssystem ist in unserem Labor etabliert und wird häufig in unserer laufenden Projekte 6,15,16 verwendet. Ein wichtiges Thema für die Expression von Shadoo ist die Wahl des E. coli-Stamm. Während kompetente BL21 Bakterienstamm wird häufig für die Expression von rekombinanten Pro verwendetProteine ​​Shadoo wurde erfolgreich exprimiert und nur aus der transformierten SoluBL21 Bakterienstamm gereinigt. SoluBL21 kompetente E. coli ist eine verbesserte Mutante BL21 Wirtsstamm für die Produktion von Proteinen, deren Expression in der Mutter BL21 gab keinen nachweisbaren löslichen Produkt entwickelt. High-Level-Expression Shadoo in SoluBL21 E. coli führt zu einer Akkumulation des Proteins in Einschlusskörpern. Als eine allgemeine Funktion, wenn ein nicht-native Protein ist stark in E. ausgedrückt coli neigt dieses Protein in unlöslicher Einschlußkörper akkumulieren. Shadoo Aggregate vermutlich durch nicht-kovalente oder ionische Wechselwirkungen hydrophobe (oder einer Kombination von beiden), um hoch angereichertes dynamischen Strukturen durch das Protein in unterschiedlichem Maße gefaltet ist. Folglich umfasst die Reinigung wenigstens zwei Schritte: (i) eine selektive Trennung des Proteins von anderen Biomolekülen in einer Denaturierung Medium und (ii) eine Renaturierung des gereinigten Proteins mit in vitro FaltungsTechniken. Die selektive Abtrennung von Shadoo wurde in einer Pufferlösung, enthaltend 8 M Harnstoff (oder alternativ 6 M Guanidin-HCl) gelöst. (I) die Renaturierung in einem sauren pH-Lösung eine unstrukturierte monomeren Shadoo Protein oder (ii) die Renaturierung in einer Lösung mit pH ≥ 7 bis Shadoo polymerisierten erhalten: Die Harnstoffentfernung und die Renaturierung des Proteins kann durch Anwendung verschiedener Protokolle durchgeführt werden in stabile Amyloidfasern mit charakteristischen Quer β-Blatt-Motive.

<table><tbody><tr><td>AKTA FPLC&amp;nbsp;</td><td>GE, Amersham</td><td># 1363</td><td></td></tr><tr><td>HiLoad 16/60 Superdex</td><td>GE Healthcare</td><td>17-1069-01</td><td></td></tr><tr><td>HiTrap IMAC</td><td>GE Healthcare</td><td>GE17-0920-05</td><td></td></tr><tr><td>HiPrep26/10 Desalting column</td><td>GE Healthcare</td><td>GE17-5087-01</td><td></td></tr><tr><td>SoluBL21 Competent E. coli</td><td>Genlantis</td><td>C700200</td><td></td></tr><tr><td>pET-28b+</td><td>Novogen</td><td>69865-3</td><td></td></tr><tr><td>IPTG</td><td>Sigma-Aldrich</td><td>I6758</td><td></td></tr><tr><td>LB-Broth medium</td><td>Sigma-Aldrich</td><td>L3022</td><td></td></tr><tr><td>Eppendorf Biophotometar</td><td>Eppendorf</td><td>550507804</td><td></td></tr><tr><td>Trito X-100</td><td>Life Technologies</td><td>85111</td><td></td></tr><tr><td>NiSO4</td><td>Sigma-Aldrich</td><td>656895</td><td></td></tr><tr><td>EDTA</td><td>Sigma-Aldrich</td><td>E6758</td><td></td></tr><tr><td>Tris-HCl</td><td>Sigma-Aldrich</td><td>RES3098T</td><td></td></tr><tr><td>Protease Inhibitor Cocktail Tablets</td><td>Roche</td><td>4693116001</td><td></td></tr><tr><td>NaCl</td><td>Sigma-Aldrich</td><td>746398</td><td></td></tr><tr><td>Imidazol</td><td>Sigma-Aldrich</td><td>I5513</td><td></td></tr><tr><td>Gdn-HCl</td><td>Sigma-Aldrich</td><td>G4505</td><td></td></tr><tr><td>protein size marker&amp;nbsp;</td><td>Thermo Fisher Scientific</td><td>26620</td><td></td></tr></tbody></table>

purification and refolding to amyloid fibrils of (his)6-tagged recombinant shadoo protein expressed as inclusion bodies in e. coli

Der Escherichia-coli-Expressionssystem ist ein leistungsfähiges Werkzeug für die Herstellung von rekombinanten eukaryotischen Proteinen. Wir verwenden es, um Shadoo, ein Protein, an das Prion-Familie gehören, zu erzeugen. Ein chromatographisches Verfahren zur Reinigung von (His) 6 -markierten rekombinanten Shadoo ausgedrückt als Einschlußkörper beschrieben. Die Einschlusskörper in 8 M Harnstoff solubilisiert und auf eine Ni 2+ -charged Säule gebunden zu Ionen-Affinitätschromatographie durchzuführen. Gebundenen Proteine ​​werden mit einem Gradienten von Imidazol eluiert. Fraktionen Shadoo Protein enthalten, werden Größenausschlußchromatographie unterzogen wird, eine hoch gereinigte Protein zu erhalten. Im letzten Schritt gereinigt Shadoo entsalzt, um Salze, Harnstoff und Imidazol zu entfernen. Rekombinante Shadoo Protein ist ein wichtiges Reagenz zur biophysikalischen und biochemischen Studien der Proteinkonformation Störungen bei Prionenerkrankungen auftreten. Viele Berichte gezeigt, dass neurodegenerative Erkrankungen Prion stammen aus der Ablagerung von Stichle, bestellt Amyloidfibrillen. Musterprotokolle beschreiben, wie Shadoo in Amyloidfibrillen bei sauren und neutralen fibrillieren / basischen pH-Werten dargestellt. Die Methoden, wie man produzieren und fibrillieren Shadoo kann Forschung in Labors arbeiten an Prionenerkrankungen zu erleichtern, da es für die Produktion von großen Mengen an Protein in eine schnelle und kostengünstige Weise.

Etwa 5-10 mg gereinigtes Shadoo Protein pro Liter Bakterienkultur erhalten. Ein Zwei-Schritt-Reinigung ist notwendig, um rekombinante Shadoo hoher Reinheit zu erhalten. Der erste Schritt ist durch Affinitätschromatographie mit einem Ni 2+ -charged Spalte, die His-Tag-Proteine ​​behält geführt. Eluierten Fraktionen werden der SDS-PAGE unterworfen und mit Coomassie Brilliant Blue (5A) angefärbt. Fraktionen Shadoo Protein enthalten, werden vereinigt und weiter durch Grßenausschlußchrom...

Watch this Scientific Journal Video about Purification and Refolding to Amyloid Fibrils of His6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli at JoVE.com

Purification and Refolding to Amyloid Fibrils of His6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli

A two-step chromatographic method is described for the purification of recombinant Shadoo protein expressed as inclusion bodies in Escherichia coli, as well as a protocol to fibrillate purified Shadoo into amyloid structures.

Reinigung und Rückfaltung an Amyloidfibrillen von (His)<sub&gt; 6</sub&gt; -markierte Recombinant Protein Shadoo als Einschlusskörper in Ausgedrückt<em&gt; E. coli</em

The Escherichia coli expression system is a powerful tool for the production of recombinant eukaryotic proteins. We use it to produce Shadoo, a protein ...

purification-refolding-to-amyloid-fibrils-his-6-tagged-recombinant

Research

JoVE Journal

Biology

Purification and Refolding to Amyloid Fibrils of (His)6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli

14.1K Aufrufe.  INRA. A two-step chromatographic method is described for the purification of recombinant Shadoo protein expressed as inclusion bodies in Escherichia coli, as well as a protocol to fibrillate purified Shadoo into amyloid structures. 

Serie: Purification and Refolding to Amyloid Fibrils of His6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli

High Precision FRET at Single-molecule Level for Biomolecule Structure Determination

A protocol on how to perform high-precision interdye distance measurements using F&#246;rster resonance energy transfer (FRET) at the single-molecule level in multiparameter fluorescence detection (MFD) mode is presented here. MFD maximizes the usage of all &#34;dimensions&#34; of fluorescence to reduce photophysical and experimental artifacts and allows for the measurement of interdye distance with an accuracy up to ~1 &#197; in rigid biomolecules. This method was used to identify three conformational states of the ligand-binding domain of the N-methyl-D-aspartate (NMDA) receptor to explain the activation of the receptor upon ligand binding. When comparing the known crystallographic structures with experimental measurements, they agreed within less than 3 &#197; for more dynamic biomolecules. Gathering a set of distance restraints that covers the entire dimensionality of the biomolecules would make it possible to provide a structural model of dynamic biomolecules.

A protocol for high-precision FRET experiments at the single molecule level is presented here. Additionally, this methodology can be used to identify three conformational states in the ligand-binding domain of the N-methyl-D-aspartate (NMDA) receptor. Determining precise distances is the first step towards building structural models based on FRET experiments.

Hochpräzisions-FRET auf Einzelmolekül-Niveau für die Bestimmung der Biomolekülstruktur

A protocol on how to perform high-precision interdye distance measurements using F&#246;rster resonance energy transfer (FRET) at the single-molecule ...

Forschung

Biochemie

From Constructs to Crystals &#8211; Towards Structure Determination of &#946;-barrel Outer Membrane Proteins

Membrane proteins serve important functions in cells such as nutrient transport, motility, signaling, survival and virulence, yet constitute only ~1% percent of known structures. There are two types of membrane proteins, &#945;-helical and &#946;-barrel. While &#945;-helical membrane proteins can be found in nearly all cellular membranes, &#946;-barrel membrane proteins can only be found in the outer membranes of mitochondria, chloroplasts, and Gram-negative bacteria. One common bottleneck in structural studies of membrane proteins in general is getting enough pure sample for analysis. In hopes of assisting those interested in solving the structure of their favorite &#946;-barrel outer membrane protein (OMP), general protocols are presented for the production of target &#946;-barrel OMPs at levels useful for structure determination by either X-ray crystallography and/or NMR spectroscopy. Here, we outline construct design for both native expression and for expression into inclusion bodies, purification using an affinity tag, and crystallization using detergent screening, bicelle, and lipidic cubic phase techniques. These protocols have been tested and found to work for most OMPs from Gram-negative bacteria; however, there are some targets, particularly for mitochondria and chloroplasts that may require other methods for expression and purification. As such, the methods here should be applicable for most projects that involve OMPs from Gram-negative bacteria, yet the expression levels and amount of purified sample will vary depending on the target OMP.

&#946;-barrel outer membrane proteins (OMPs) serve many functions within the outer membranes of Gram-negative bacteria, mitochondria, and chloroplasts. Here, we hope to alleviate a known bottleneck in structural studies by presenting protocols for the production of &#946;-barrel OMPs in sufficient quantities for structure determination by X-ray crystallography or NMR spectroscopy.

Von Konstrukten Crystals - Auf dem Weg zu Strukturbestimmung von β-Fass-Außenmembranproteine

Membrane proteins serve important functions in cells such as nutrient transport, motility, signaling, survival and virulence, yet constitute only ~1% ...

Chemie

Method for Efficient Refolding and Purification of Chemoreceptor Ligand Binding Domain

Identification of natural ligands of chemoreceptors and structural studies aimed at elucidation of the molecular basis of the ligand specificity can be greatly facilitated by the production of milligram amounts of pure, folded ligand binding domains. Attempts to heterologously express periplasmic ligand binding domains of bacterial chemoreceptors in Escherichia coli (E. coli) often result in their targeting into inclusion bodies. Here, a method is presented for protein recovery from inclusion bodies, its refolding and purification, using the periplasmic dCACHE ligand binding domain of Campylobacter jejuni (C. jejuni) chemoreceptor Tlp3 as an example. The approach involves expression of the protein of interest with a cleavable His6-tag, isolation and urea-mediated solubilisation of inclusion bodies, protein refolding by urea depletion, and purification by means of affinity chromatography, followed by tag removal and size-exclusion chromatography. The circular dichroism spectroscopy is used to confirm the folded state of the pure protein. It has been demonstrated that this protocol is generally useful for production of milligram amounts of dCACHE periplasmic ligand binding domains of other bacterial chemoreceptors in a soluble and crystallisable form.

A procedure is presented for the refolding of the dCACHE periplasmic ligand binding domain of Campylobacter jejuni chemoreceptor Tlp3 from inclusion bodies and the purification to yield milligram quantities of protein.

Methode für effiziente Umfaltung und Reinigung des Chemorezeptor-Liganden-bindende Domäne

Identification of natural ligands of chemoreceptors and structural studies aimed at elucidation of the molecular basis of the ligand specificity can be ...

Purification and Aggregation of the Amyloid Precursor Protein Intracellular Domain

Amyloid precursor protein (APP) is a type I transmembrane protein associated with the pathogenesis of Alzheimer's disease (AD). APP is characterized by a large extracellular domain and a short cytosolic domain termed the APP intracellular domain (AICD). During maturation through the secretory pathway, APP can be cleaved by proteases termed &alpha;, &beta;, and &gamma;-secretases1. Sequential proteolytic cleavage of APP with &beta; and &gamma;-secretases leads to the production of a small proteolytic peptide, termed A&beta;, which is amyloidogenic and the core constituent of senile plaques. The AICD is also liberated from the membrane after secretase processing, and through interactions with Fe65 and Tip60, can translocate to the nucleus to participate in transcription regulation of multiple target genes2,3. Protein-protein interactions involving the AICD may affect trafficking, processing, and cellular functions of holo-APP and its C-terminal fragments. We have recently shown that AICD can aggregate in vitro, and this process is inhibited by the AD-implicated molecular chaperone ubiquilin-14. Consistent with these findings, the AICD has exposed hydrophobic domains and is intrinsically disordered in vitro5,6, however it obtains stable secondary structure when bound to Fe657. We have proposed that ubiquilin-1 prevents inappropriate inter- and intramolecular interactions of AICD, preventing aggregation in vitro and in intact cells4. While most studies focus on the role of APP in the pathogenesis of AD, the role of AICD in this process is not clear. Expression of AICD has been shown to induce apoptosis8, to modulate signaling pathways9, and to regulate calcium signaling10. Over-expression of AICD and Fe65 in a transgenic mouse model induces Alzheimer's like pathology11, and recently AICD has been detected in brain lysates by western blotting when using appropriate antigen retrieval techniques12. To facilitate structural, biochemical, and biophysical studies of the AICD, we have developed a procedure to produce recombinantly large amounts of highly pure AICD protein. We further describe a method for inducing the in vitro thermal aggregation of AICD and analysis by atomic force microscopy. The methods described are useful for biochemical, biophysical, and structural characterization of the AICD and the effects of molecular chaperones on AICD aggregation.

A method for large-scale purification of the APP intracellular domain (AICD) is described. We also describe methodology to induce in vitro AICD aggregation and visualization by atomic force microscopy. The methods described are useful for biochemical/structural characterization of the AICD and the effects of molecular chaperones on its aggregation.

Reinigung und Aggregation des Amyloid Precursor Protein intrazelluläre Domäne

Amyloid precursor protein (APP) is a type I transmembrane protein associated with the pathogenesis of Alzheimer's disease (AD). APP is characterized by a ...

Medizin

Synthesis of an Intein-mediated Artificial Protein Hydrogel

We present the synthesis of a highly stable protein hydrogel mediated by a split-intein-catalyzed protein trans-splicing reaction. The building blocks of this hydrogel are two protein block-copolymers each containing a subunit of a trimeric protein that serves as a crosslinker and one half of a split intein. A highly hydrophilic random coil is inserted into one of the block-copolymers for water retention. Mixing of the two protein block copolymers triggers an intein trans-splicing reaction, yielding a polypeptide unit with crosslinkers at either end that rapidly self-assembles into a hydrogel. This hydrogel is very stable under both acidic and basic conditions, at temperatures up to 50 &#176;C, and in organic solvents. The hydrogel rapidly reforms after shear-induced rupture. Incorporation of a &#34;docking station peptide&#34; into the hydrogel building block enables convenient incorporation of &#34;docking protein&#34;-tagged target proteins. The hydrogel is compatible with tissue culture growth media, supports the diffusion of 20 kDa molecules, and enables the immobilization of bioactive globular proteins. The application of the intein-mediated protein hydrogel as an organic-solvent-compatible biocatalyst was demonstrated by encapsulating the horseradish peroxidase enzyme and corroborating its activity.

We present the synthesis of a split-intein-mediated protein hydrogel. The building blocks of this hydrogel are two protein copolymers each containing a subunit of a trimeric protein that serves as a crosslinker and one half of a split intein. Mixing of the two protein copolymers triggers an intein trans-splicing reaction, yielding a polypeptide unit that self-assembles into a hydrogel. This hydrogel is highly pH- and temperature-stable, compatible with organic solvents, and easily incorporates functional globular proteins.

Synthese einer Intein-vermittelten Protein-Hydrogel Künstliche

We present the synthesis of a highly stable protein hydrogel mediated by a split-intein-catalyzed protein trans-splicing reaction. The building blocks of ...

Biotechnik

Expression, Purification, Crystallization, and Enzyme Assays of Fumarylacetoacetate Hydrolase Domain-Containing Proteins

Fumarylacetoacetate hydrolase (FAH) domain-containing proteins (FAHD) are identified members of the FAH superfamily in eukaryotes. Enzymes of this superfamily generally display multi-functionality, involving mainly hydrolase and decarboxylase mechanisms. This article presents a series of consecutive methods for the expression and purification of FAHD proteins, mainly FAHD protein 1 (FAHD1) orthologues among species (human, mouse, nematodes, plants, etc.). Covered methods are protein expression in E. coli, affinity chromatography, ion exchange chromatography, preparative and analytical gel filtration, crystallization, X-ray diffraction, and photometric assays. Concentrated protein of high levels of purity (&#62;98%) may be employed for crystallization or antibody production. Proteins of similar or lower quality may be employed in enzyme assays or used as antigens in detection systems (Western-Blot, ELISA). In the discussion of this work, the identified enzymatic mechanisms of FAHD1 are outlined to describe its hydrolase and decarboxylase bi-functionality in more detail.

Expression and purification of fumarylacetoacetate hydrolase domain-containing proteins is described with examples (expression in E. coli, FPLC). Purified proteins are used for crystallization and antibody production and employed for enzyme assays. Selected photometric assays are presented to display the multi-functionality of FAHD1 as oxaloacetate decarboxylase and acylpyruvate hydrolase.

Expression, Reinigung, Kristallisation und Enzym-Assays von Fumarylacetoacetat-Hydrolase-Domänen-haltigen Proteinen

Fumarylacetoacetate hydrolase (FAH) domain-containing proteins (FAHD) are identified members of the FAH superfamily in eukaryotes. Enzymes of this ...

Targeting Cysteine Thiols for in Vitro Site-specific Glycosylation of Recombinant Proteins

Stromal interaction molecule-1 (STIM1) is a type-I transmembrane protein located on the endoplasmic reticulum (ER) and plasma membranes (PM). ER-resident STIM1 regulates the activity of PM Orai1 channels in a process known as store operated calcium (Ca2+) entry which is the principal Ca2+ signaling process that drives the immune response. STIM1 undergoes post-translational N-glycosylation at two luminal Asn sites within the Ca2+ sensing domain of the molecule. However, the biochemical, biophysical, and structure biological effects of N-glycosylated STIM1 were poorly understood until recently due to an inability to readily obtain high levels of homogeneous N-glycosylated protein. Here, we describe the implementation of an in vitro chemical approach which attaches glucose moieties to specific protein sites applicable to understanding the underlying effects of N-glycosylation on protein structure and mechanism. Using solution nuclear magnetic resonance spectroscopy we assess both efficiency of the modification as well as the structural consequences of the glucose attachment with a single sample. This approach can readily be adapted to study the myriad glycosylated proteins found in nature.

Targeting Cysteine Thiols for in Vitro Site-specific Glycosylation of Recombinant Proteins

Biochemical and structural analyses of glycosylated proteins require relatively large amounts of homogeneous samples. Here, we present an efficient chemical method for site-specific glycosylation of recombinant proteins purified from bacteria by targeting reactive Cys thiols.

Targeting Cystein Thiole für in-vitro- standortspezifische Glykosylierung von rekombinanten Proteinen

Stromal interaction molecule-1 (STIM1) is a type-I transmembrane protein located on the endoplasmic reticulum (ER) and plasma membranes (PM). ER-resident ...

Immunologie und Infektion

Purification of Hsp104, a Protein Disaggregase

Hsp104 is a hexameric AAA+ protein1 from yeast, which couples ATP hydrolysis to protein disaggregation2-10 (Fig. 1). This activity imparts two key selective advantages. First, renaturation of disordered aggregates by Hsp104 empowers yeast survival after various protein-misfolding stresses, including heat shock3,5,11,12. Second, remodeling of cross-beta amyloid fibrils by Hsp104 enables yeast to exploit myriad prions (infectious amyloids) as a reservoir of beneficial and heritable phenotypic variation13-22. Remarkably, Hsp104 directly remodels preamyloid oligomers and amyloid fibrils, including those comprised of the yeast prion proteins Sup35 and Ure223-30. This amyloid-remodeling functionality is a specialized facet of yeast Hsp104. The E. coli orthologue, ClpB, fails to remodel preamyloid oligomers or amyloid fibrils26,31,32.
Hsp104 orthologues are found in all kingdoms of life except, perplexingly, animals. Indeed, whether animal cells possess any enzymatic system that couples protein disaggregation to renaturation (rather than degradation) remains unknown33-35. Thus, we and others have proposed that Hsp104 might be developed as a therapeutic agent for various neurodegenerative diseases connected with the misfolding of specific proteins into toxic preamyloid oligomers and amyloid fibrils4,7,23,36-38. There are no treatments that directly target the aggregated species associated with these diseases. Yet, Hsp104 dissolves toxic oligomers and amyloid fibrils composed of alpha-synuclein, which are connected with Parkinson's Disease23 as well as amyloid forms of PrP39. Importantly, Hsp104 reduces protein aggregation and ameliorates neurodegeneration in rodent models of Parkinson's Disease23 and Huntington's disease38. Ideally, to optimize therapy and minimize side effects, Hsp104 would be engineered and potentiated to selectively remodel specific aggregates central to the disease in question4,7. However, the limited structural and mechanistic understanding of how Hsp104 disaggregates such a diverse repertoire of aggregated structures and unrelated proteins frustrates these endeavors30,40-42.
To understand the structure and mechanism of Hsp104, it is essential to study the pure protein and reconstitute its disaggregase activity with minimal components. Hsp104 is a 102kDa protein with a pI of ~5.3, which hexamerizes in the presence of ADP or ATP, or at high protein concentrations in the absence of nucleotide43-46. Here, we describe an optimized protocol for the purification of highly active, stable Hsp104 from E. coli. The use of E. coli allows simplified large-scale production and our method can be performed quickly and reliably for numerous Hsp104 variants. Our protocol increases Hsp104 purity and simplifies His6-tag removal compared to a previous purification method from E. coli47. Moreover, our protocol is more facile and convenient than two more recent protocols26,48.

Here, we describe a protocol for the purification of highly active Hsp104, a hexameric AAA+ protein from yeast, which couples ATP hydrolysis to protein disaggregation. This scheme exploits a His6-tagged construct for affinity purification from E. coli followed by anion-exchange chromatography, His6-tag removal with TEV protease, and size-exclusion chromatography.

Reinigung von Hsp104, ein Protein Disaggregase

Hsp104 is a hexameric AAA+ protein1 from yeast, which couples ATP hydrolysis to protein disaggregation2-10 (Fig. 1). This activity imparts two key ...

Biologie

Production of E. coli-expressed Self-Assembling Protein Nanoparticles for Vaccines Requiring Trimeric Epitope Presentation

Self-assembling protein nanoparticles (SAPNs) function as repetitive antigen displays and can be used to develop a wide range of vaccines for different infectious diseases. In this article we demonstrate a method to produce a SAPN core containing a six-helix bundle (SHB) assembly that is capable of presenting antigens in a trimeric conformation. We describe the expression of the SHB-SAPN in an E. coli system, as well as the necessary protein purification steps. We included an isopropanol wash step to reduce the residual bacterial lipopolysaccharide. As an indication of the protein identity and purity, the protein reacted with known monoclonal antibodies in Western blot analyses. After refolding, the size of the particles fell in the expected range (20 to 100 nm), which was confirmed by dynamic light scattering, nanoparticle tracking analysis, and transmission electron microscopy. The methodology described here is optimized for the SHB-SAPN, however, with only slight modifications it can be applied to other SAPN constructs. This method is also easily transferable to large scale production for GMP manufacturing for human vaccines.

Production of E. coli-expressed Self-Assembling Protein Nanoparticles for Vaccines Requiring Trimeric Epitope Presentation

A detailed method is provided here describing the purification, refolding, and characterization of self-assembling protein nanoparticles (SAPNs) for use in vaccine development.

Herstellung von E. coli-exprimierenden selbstmontierenden Protein-Nanopartikeln für Impfstoffe, die eine trimerische Epitop-Präsentation erfordern

Self-assembling protein nanoparticles (SAPNs) function as repetitive antigen displays and can be used to develop a wide range of vaccines for different ...

Rapid Generation of Amyloid from Native Proteins In vitro

Proteins carry out crucial tasks in organisms by exerting functions elicited from their specific three dimensional folds. Although the native structures of polypeptides fulfill many purposes, it is now recognized that most proteins can adopt an alternative assembly of beta-sheet rich amyloid. Insoluble amyloid fibrils are initially associated with multiple human ailments, but they are increasingly shown as functional players participating in various important cellular processes. In addition, amyloid deposited in patient tissues contains nonproteinaceous components, such as nucleic acids and glycosaminoglycans (GAGs). These cofactors can facilitate the formation of amyloid, resulting in the generation of different types of insoluble precipitates. By taking advantage of our understanding how proteins misfold via an intermediate stage of soluble amyloid precursor, we have devised a method to convert native proteins to amyloid fibrils in vitro. This approach allows one to prepare amyloid in large quantities, examine the properties of amyloid generated from specific proteins, and evaluate the structural changes accompanying the conversion.

Rapid Generation of Amyloid from Native Proteins In vitro

Proteins can either adopt a native structure or misfold into insoluble amyloid. Conditions that favor the misfolding pathway lead to the formation of different types of amyloid fibrils. The methods described here allow rapid conversion of native proteins into amyloid in vitro.

Proteins carry out crucial tasks in organisms by exerting functions elicited from their specific three dimensional folds. Although the native structures ...

Reinigung und Rückfaltung an Amyloidfibrillen von (His)

Zusammenfassung

Weitere Videos entdecken

Kapitel in diesem Video

Hochpräzisions-FRET auf Einzelmolekül-Niveau für die Bestimmung der Biomolekülstruktur

Von Konstrukten Crystals - Auf dem Weg zu Strukturbestimmung von β-Fass-Außenmembranproteine

Methode für effiziente Umfaltung und Reinigung des Chemorezeptor-Liganden-bindende Domäne

Reinigung und Aggregation des Amyloid Precursor Protein intrazelluläre Domäne

Synthese einer Intein-vermittelten Protein-Hydrogel Künstliche

Expression, Reinigung, Kristallisation und Enzym-Assays von Fumarylacetoacetat-Hydrolase-Domänen-haltigen Proteinen

Targeting Cystein Thiole für in-vitro- standortspezifische Glykosylierung von rekombinanten Proteinen

Reinigung von Hsp104, ein Protein Disaggregase

Herstellung von E. coli-exprimierenden selbstmontierenden Protein-Nanopartikeln für Impfstoffe, die eine trimerische Epitop-Präsentation erfordern

Rapid Generation of Amyloid from Native Proteins In vitro