The authors would like to acknowledge Natalie Doude and David Westerway (University of Alberta) for providing us Sho cDNA, Christophe Chevalier (INRA) for plasmid construction, Michel Br&#233;mont (INRA) for providing us BL21Sol bacteria; Christine Longin (INRA) for TEM assistance and Edith Pajot-Augy (INRA) for comments and proofreading.

1. Génération du plasmide d&#39;expression et Shadoo Remarque: le gène codant pour la protéine murine Shadoo (Shadoo 25-122), a été sous-cloné dans le vecteur d&#39;expression pET-28 11. Ce clone a été transformé dans E. coli SoluBL21 souche bactérienne, pour exprimer la protéine Shadoo avec une étiquette hexahistidine N-terminale, (HHHHHHHHHHSSGHIDDDDKHMKGGRGGARGSARGVRGGARGASRVRVRP APRYGSSLRVAAAGAAAGAAAGVAAGLATGSGWRRTSGPGELGLEDDENGAMGGNGTDRGVYSYWAWTSG) comme expliqué précédemment 11. Le plasmide peut être demandé auprès des auteurs. Le poids moléculaire calculé à partir de Shadoo sa séquence d&#39;acides aminés est 12,243.2 Da. Remarque: Effectuez toutes les manipulations avec des bactéries sous une hotte à flux laminal ou à proximité de Bunsen flamme. <ol><li> Transformer des bactéries de SoluBL21 compétentes avec l&#39;animal-28-His 6 -Shadoo plasmide, en utilisant un protocole de choc thermique standard. Pour ce mélange 1 à 5 ul de plasmide (10 pg typiquement à 100ng) dans 50 ul de bactéries dans un tube. Effectuer le choc thermique à 42 ° C pendant 45 secondes. </li><li> Culture des bactéries transformées à 37 ° C jusqu&#39;à ce que 0,5 à 0,7 A 600 en milieu Luria-Bertani complété avec 40 mg / ml de kanamycine (Figure 1B). </li><li> Induire l&#39;expression Shadoo O / N par addition de 240 ug / ml de β-isopropyl-D- thiogalactopyranoside, ITPG, à la culture. Les bactéries de la Culture sous agitation à 150 tours par minute à 37 ° C. Remarque: En règle générale, la culture bactérienne a atteint 600 A du 3 O / N. Remarque: Transformé bactéries peuvent être conservés à -80 ° C pour l&#39;avenir de la production de protéines. Pour cela, ajoutez 10% à 50% (v / v) de glycérol stérile dans des aliquotes de culture bactérienne et les congeler à -80 ° C. </li></ol><img alt="Figure 1" src="/files/ftp_upload/53432/53432fig1.jpg" /> Figure 1. Schéma de Shadoo construction d&#39;expression, bactéries transformation et induction de l&#39;expression Shadoo (comme décrit dans l&#39;étape 1). </strong&gt; (A) Le produit d&#39;assemblage d&#39;expression pour Shadoo code pour une étiquette hexahistidine fusionné à l&#39;extrémité N-terminale de la protéine, le Nt. Le schéma montre que la protéine de base contient des répétitions Shadoo arginine / glycine (vert) de cylindre, un domaine hydrophobe (HD), et un seul site de N-glycosylation (CHO), suivie d&#39;une extrémité C-terminale (Ct). (B) Le PET-28-His 6 -Shadoo plasmide est transformé dans des bactéries SoluBL21 par choc thermique pendant 45 secondes à 42 ° C. Les bactéries transformées sont étalées sur de la gélose sélectif contenant 40 ug / ml de kanamycine. Une colonie unique de la plaque est utilisée pour inoculer une culture dans un flacon secoueur 1.000-3.000 ml. L&#39;expression de la protéine recombinante est induite avec IPTG 1 mM. <a href="https://www.jove.com/files/ftp_upload/53432/53432fig1highres.jpg" target="_blank">S&#39;il vous plaît cliquez ici pour voir une version plus grande de cette figure.</a> 2. Purification de Shadoo protéines par chromatographie en phase liquide à basse pression (LPLC) <ol><li> La lyse des cellules et enconclusion organes préparation <ol><li> Recueillir la suspension bactérienne et de la transférer dans des tubes de centrifugation (figure 2). </li><li> Spin à 2500 xg, pendant 20 min à 4 ° C. Retirer le surnageant par décantation et des pastilles de remettre en suspension dans 15 ml de tampon (Tris 50 mM, EDTA 10 mM, pH 8 avec un cocktail anti-protéase) pour chaque pastille provenant de 500 ml de culture cellulaire. Remarque: Les culots remis en suspension peuvent être congelés et conservés à -20 ° C pendant plusieurs jours. La congélation des cellules bactériennes facilite la lyse. </li><li> Vérifiez la sur-expression de la protéine recombinante en utilisant des bactéries brut pastilles par l&#39;analyse SDS-PAGE et coloration de Coomassie. <ol><li> Pour cela, centrifuger 1 ml de culture bactérienne pour sédimenter les cellules. Ajouter 100 ul de solution de dénaturation Laemmli (277,8 mM de Tris-HCl, pH 6,8, 4,4% de SDS, 44,4% en poids / volume de glycerol, 0,02% de bleu de bromophénol) pour former un culot et on chauffe à 100 ° C pendant 5 min. </li><li> Charge 10 pi de l&#39;échantillon à un gel d&#39;acrylamide 12%, exécutez SDS-PAGE et visualize protéines séparées par coloration de Coomassie. </li></ol></li><li> Ajouter Triton X-100 à 0,5% à une concentration finale complètement remis en suspension le culot de 2.1.2). </li><li> Incuber la suspension dans un bain d&#39;eau à 37 ° C pendant 30 min. </li><li> Soniquer la suspension pendant 5 minutes à 6-12 microns d&#39;amplitude crête-à-crête dans de l&#39;eau glacée pour lyser les cellules bactériennes. </li><li> Transfert soniquée suspension dans 50 ml propres tubes de centrifugation. </li><li> Tubes à centrifuger à 15000 g pendant 15 min à 4 ° C. </li><li> Retirer le surnageant par décantation et ajouter 5 ml de tampon de liaison (tampon 20 mM Tris-HCl, pH 7,4, NaCl 0,5 M, urée 8 M, 5 mM d&#39;imidazole) par tube. </li><li> Placer les tubes sur la roue tournante O / N pour une suspension complète des protéines de corps d&#39;inclusion. </li></ol><img alt="Figure 2" src="/files/ftp_upload/53432/53432fig2.jpg" /> Figure 2. Schéma de purification de l&#39;inclusiondes organes (comme décrit à l&#39;étape 2.1). transformées bactéries exprimant Shadoo sont récoltées par centrifugation et remises en suspension dans le tampon de lyse. La suspension est incubée à 37 ° C pendant 30 min, puis traitée par ultrasons pour briser mécaniquement les cellules bactériennes. Sonication se fait sur la glace pour éviter l&#39;échauffement de l&#39;échantillon. Cellules brisées sont récoltées par centrifugation et remises en suspension dans un tampon contenant de l&#39;urée 8M pour solubiliser des protéines de corps d&#39;inclusion. <a href="https://www.jove.com/files/ftp_upload/53432/53432fig2highres.jpg" target="_blank">S&#39;il vous plaît cliquer ici pour voir une version plus grande de cette figure.</a> </li><li> La Chromatographie de Ni 2+ Remarque: La chromatographie est effectuée sur un système FPLC en utilisant -charged Ni 2+, 5 ml de Sepharose chélatant colonne (figure 3A). Toutes les solutions sont chargées sur la colonne avec un débit de 1 ml / min de débit. <ol><li> Injecter 10 ml de 0,2 M NiSO solution 4 de l&#39;eau dans la colonne Sepharose afin de la rechargeravec les -ions de Ni. </li><li> Equilibrer la colonne chargée avec Ni 2+ -ions par injection de 30 à 50 ml de tampon de liaison contenant de la faible concentration d&#39;imidazole (20 mM de tampon Tris-HCl, pH 7,4, NaCl 0,5 M, urée 8 M, 5 mM d&#39;imidazole). </li><li> Charger les protéines de l&#39;urée solubilisé avec une boucle d&#39;injection de 50 ml. </li><li> Récupérer la fraction à écoulement continu par un lavage soigneux de la colonne avec 10 ml de tampon à faible imidazole de liaison (tampon 20 mM Tris-HCl, pH 7,4, NaCl 0,5 M, urée 8 M, mM d&#39;imidazole 5) afin d&#39;éliminer au maximum les protéines non liées à partir de la colonne. </li><li> Laver la colonne avec 50 à 100 ml du tampon de lavage (20 mM Tris-HCl, pH 7,4, NaCl 0,5 M, urée 8 M, 80 mM d&#39;imidazole) pour éluer les protéines non spécifiquement liées à la colonne. </li><li> Application d&#39;un gradient linéaire de 15 min de 80 à 800 mM d&#39;imidazole dans le tampon contenant 20 mM de Tris-HCl, pH 7,4, NaCl 0,5 M, urée 8 M. Prélever 1 ml fractions lors de l&#39;application de gradient. Remarque: protéines His-tagged sont élues espritha gradient de tampon contenant de l&#39;imidazole (utilisé en tant que concurrent). </li><li> Prendre une aliquote de 8 pi de chaque fraction et ajouter 4 ul solution de dénaturation 4x Laemmli (voir 2.1.3.1). Solutions de chaleur à 100 ° C pendant 5 min. </li><li> Charge 10 pi de marqueur de taille de protéines et 10 pi de chaque échantillon sur le gel d&#39;acrylamide 12%, exécuter SDS-PAGE et de visualiser des protéines séparées par coloration de Coomassie. Remarque: Le poids moléculaire de Shadoo calculée former sa séquence d&#39;acides aminés est 12,243.2 Da. </li><li> Piscine toutes les fractions contenant Shadoo. </li></ol><img alt="Figure 3" src="/files/ftp_upload/53432/53432fig3.jpg" /> Figure 3. Procédure de purification (comme décrit dans les étapes 2.2-2.4). (A) Ni 2+ -ions peuvent être coordonnés par des résidus d&#39;histidine, ce qui permet la purification sélective des protéines à marquage polyhistidine. Imidazole est utilisé pour éluer la protéine, par l&#39;intermédiairesa capacité à assurer la coordination avec le Ni 2+ et d&#39;ion déplacer la protéine liée. (B) Des protéines de faire varier le rayon hydrodynamique qui ont été retenues sur le Ni 2+ -column sont séparés sur une colonne d&#39;exclusion de taille. Les protéines sont élues de la plus grande à la plus petites. (C) Avant d&#39;utiliser, fractions contenant Shadoo sont regroupées et dessalées pour éliminer l&#39;urée, de l&#39;imidazole et de sels. Des analyses de contrôle de qualité comprennent SDS-PAGE / coloration de Coomassie, Western blot. Purifiée Shadoo peut être lyophilisé. Lyophilisée Shadoo est stable pendant des mois lorsqu&#39;il est stocké à -20 ° C. <a href="https://www.jove.com/files/ftp_upload/53432/53432fig3highres.jpg" target="_blank">S&#39;il vous plaît cliquez ici pour voir une version plus grande de cette figure.</a> </li><li> Chromatographie d&#39;exclusion de taille Remarque: Une deuxième étape de purification consiste en une chromatographie d&#39;exclusion de taille qui sépare Shadoo protéine des autres protéines co-éluées au cours de la première étape de purification(Figure 3B). <ol><li> Equilibrer la colonne Superdex de 120 ml de volume de lit en injectant au total 250 ml de tampon 20 mM Tris-HCl, pH 7,4, NaCl 0,5 M, urée 8 M, à raison de 1,5 ml / min. </li><li> Charger les fractions regroupées contenant Shadoo du 2.2.9 sur la colonne équilibrée. Prélever 1 ml fractions après le volume de 40 ml de colonne vide sur le flux constant de tampon ci-dessus. </li><li> Prenez une aliquote de 10 pi de chaque fraction et effectuer une analyse SDS-PAGE et coloration de Coomassie comme décrit ci-dessus pour savoir qui fractions contiennent Shadoo. </li><li> Fractions de piscine contenant Shadoo. </li></ol></li><li> Dessalage Remarque: la procédure de dessalage supprime sels, l&#39;imidazole et de l&#39;urée pour obtenir la protéine recombinante Shadoo dans un tampon approprié pour d&#39;autres études biophysiques et biochimiques (figure 3C). Le même résultat peut être obtenu par dialyse contre le tampon d&#39;échantillons. <ol><li> Équilibrer une colonne de dessalage de 53 ml avec 150 ml10 mM de tampon d&#39;acétate d&#39;ammonium, pH 5, à raison de 5 ml / min de débit. </li><li> Charge fractions rassemblées Shadoo sur la colonne. Lors de l&#39;injection du tampon d&#39;acétate d&#39;ammonium collecter manuellement les fractions qui présentent une augmentation du signal à 280 nm à la sortie du détecteur d&#39;UV. </li><li> Lyophiliser la Shadoo dessalée et de le stocker à -20 ° C. </li><li> Dissoudre Shadoo lyophilisée dans un tampon adéquat, un tampon d&#39;acétate de sodium comme 10 mM, pH 5, avant l&#39;utilisation. Remarque: L&#39;étiquette polyhistidine peut être enlevé avec une entérokinase. </li></ol></li></ol> 3. In Vitro Assemblage des Shadoo en fibrilles d&#39;amyloïde à pH physiologique Note: Les agrégats de protéines Shadoo et spontanément forme fibrilles à pH ≥ 7 11. <img alt="Figure 4" src="/files/ftp_upload/53432/53432fig4.jpg" /> Figure 4. Schéma de Shadoo repliement de fibrilles amyloïdes (comme description figurelit dans l&#39;étape 3). Shadoo purifiée transforme spontanément de fibrilles amyloïdes lorsqu&#39;il est dissous dans du tampon pH ≥ 7. Dans une solution acide, Shadoo convertit en fibrilles amyloïdes lors d&#39;une incubation avec 1 M HCl Gdn-tout en agitant. Des analyses de contrôle de la qualité comprennent microscopie électronique et ThT coloration. <a href="https://www.jove.com/files/ftp_upload/53432/53432fig4highres.jpg" target="_blank">S&#39;il vous plaît cliquer ici pour voir une version plus grande de cette figure.</a> <ol><li> Diluer Shadoo à une concentration finale de 2 uM dans un tampon 20 mM Tris-HCl, pH 7,4. Mesurer la concentration en mesurant la densité optique de la solution à 280 nm et en utilisant le coefficient d&#39;extinction déduite de Shadoo composition d&#39;acides aminés de 20 970. </li><li> Incuber 500 ul de la solution dans un tube conique en plastique à 4 ° C pendant une quinzaine de jours, pour permettre la conversion de la protéine spontanée de structures amyloïdes (figure 4). </li><li> Ajout fraîchement préparé thioflavine T (THT) à un conce finalentration de 10 uM à une portion aliquote de 100 ul de la solution Shadoo. Incuber la solution pendant 5 min à température ambiante. Mesurer l&#39;émission de fluorescence de 460 à 520 nm en utilisant une longueur d&#39;onde d&#39;excitation de 435 nm pour vérifier la présence de structures amyloïdes 17. </li></ol> 4. In Vitro Assemblage des Shadoo d&#39;amyloïde fibrilles au pH acides <ol><li> Diluer à 1 M Shadoo GdnHCl, 20 mM de tampon acétate-Na, pH 5 à une concentration finale de 2 uM. </li><li> Incuber 500 ul de cette solution dans un tube conique avec agitation continue à 37 ° C, pendant 3-7 jours. </li><li> Vérifier la présence de fibrilles amyloïdes en ajoutant ThT à une aliquote de la solution comme dans 3.3. </li><li> Dialyser suspension obtenue contre un tampon 10 mM d&#39;acétate de Na, pH 5,0, à purifier Shadoo fibrilles amyloïdes. </li><li> Stockez fibrilles purifiés à +4 ° C. </li></ol><img alt="Figure 5" src="/files/ftp_upload/53432/53432fig5.jpg"/&gt; Figure 5. Les résultats représentatifs. Fractions de protéines éluées à partir de la colonne Ni 2+ -charged chélateur (A) et de la colonne d&#39;exclusion de taille (B) ont été analysés en utilisant une SDS-PAGE et coloration au bleu de Coomassie. Identification des Shadoo purifiée a été évaluée en utilisant un anticorps anti-Shadoo RRPS (C). <a href="https://www.jove.com/files/ftp_upload/53432/53432fig5large.jpg" target="_blank">S&#39;il vous plaît cliquez ici pour voir une version plus grande de cette figure.</a>

<ol>
	<li>Biasini, E., Turnbaugh, J. A., Unterberger, U., Harris, D. A. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Prion+protein+at+the+crossroads+of+physiology+and+disease.">Prion protein at the crossroads of physiology and disease.</a> Trends in Neurosciences. 35, 92-103 (2012).</li><li>Colby, D. W., Prusiner, S. B. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=De+novo+generation+of+prion+strains.">De novo generation of prion strains.</a> Nature Reviews. Microbiology. 9, 771-777 (2011).</li><li>Chiti, F., Dobson, C. M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Protein+misfolding,+functional+amyloid,+and+human+disease.">Protein misfolding, functional amyloid, and human disease.</a> Annual Review of Biochemistry. 75, 333-366 (2006).</li><li>Nelson, R., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Structure+of+the+cross-beta+spine+of+amyloid-like+fibrils.">Structure of the cross-beta spine of amyloid-like fibrils.</a> Nature. 435, 773-778 (2005).</li><li>Murphy, R. M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Kinetics+of+amyloid+formation+and+membrane+interaction+with+amyloidogenic+proteins.">Kinetics of amyloid formation and membrane interaction with amyloidogenic proteins.</a> Biochimica et Biophysica Acta. 1768, 1923-1934 (2007).</li><li>Steunou, S., Chich, J. F., Rezaei, H., Vidic, J. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Biosensing+of+lipid-prion+interactions:+insights+on+charge+effect,+Cu(II)-ions+binding+and+prion+oligomerization.">Biosensing of lipid-prion interactions: insights on charge effect, Cu(II)-ions binding and prion oligomerization.</a> Biosensors &amp; Bioelectronics. 26, 1399-1406 (2010).</li><li>Watts, J. C., Westaway, D. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+prion+protein+family:+diversity,+rivalry,+and+dysfunction.">The prion protein family: diversity, rivalry, and dysfunction.</a> Biochimica et Biophysica Acta. 1772, 654-672 (2007).</li><li>Westaway, D., Daude, N., Wohlgemuth, S., Harrison, P. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+PrP-like+proteins+Shadoo+and+Doppel.">The PrP-like proteins Shadoo and Doppel.</a> Topics in Current Chemistry. 305, 225-256 (2011).</li><li>Baillod, P., Garrec, J., Tavernelli, I., Rothlisberger, U. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Prion+versus+doppel+protein+misfolding:+new+insights+from+replica-exchange+molecular+dynamics+simulations.">Prion versus doppel protein misfolding: new insights from replica-exchange molecular dynamics simulations.</a> Biochemistry. 52, 8518-8526 (2013).</li><li>Daude, N., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Wild-type+Shadoo+proteins+convert+to+amyloid-like+forms+under+native+conditions.">Wild-type Shadoo proteins convert to amyloid-like forms under native conditions.</a> Journal of Neurochemistry. 113, 92-104 (2010).</li><li>Li, Q., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Shadoo+binds+lipid+membranes+and+undergoes+aggregation+and+fibrillization.">Shadoo binds lipid membranes and undergoes aggregation and fibrillization.</a> Biochemical and Biophysical Research Communications. 438, 519-525 (2013).</li><li>Watts, J. C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+CNS+glycoprotein+Shadoo+has+PrP(C)-like+protective+properties+and+displays+reduced+levels+in+prion+infections.">The CNS glycoprotein Shadoo has PrP(C)-like protective properties and displays reduced levels in prion infections.</a> The EMBO Journal. 26, 4038-4050 (2007).</li><li>Watts, J. C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Protease-resistant+prions+selectively+decrease+Shadoo+protein.">Protease-resistant prions selectively decrease Shadoo protein.</a> PLoS Pathogens. 7, e1002382 (2011).</li><li>Westaway, D., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Down-regulation+of+Shadoo+in+prion+infections+traces+a+pre-clinical+event+inversely+related+to+PrP(Sc)+accumulation.">Down-regulation of Shadoo in prion infections traces a pre-clinical event inversely related to PrP(Sc) accumulation.</a> PLoS Pathogens. 7, e1002391 (2011).</li><li>Chevalier, C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=PB1-F2+influenza+A+virus+protein+adopts+a+beta-sheet+conformation+and+forms+amyloid+fibers+in+membrane+environments.">PB1-F2 influenza A virus protein adopts a beta-sheet conformation and forms amyloid fibers in membrane environments.</a> The Journal of Biological Chemistry. 285, 13233-13243 (2010).</li><li>Tarus, B., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Oligomerization+paths+of+the+nucleoprotein+of+influenza+A+virus.">Oligomerization paths of the nucleoprotein of influenza A virus.</a> Biochimie. 94, 776-785 (2012).</li><li>Biancalana, M., Koide, S. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Molecular+mechanism+of+Thioflavin-T+binding+to+amyloid+fibrils.">Molecular mechanism of Thioflavin-T binding to amyloid fibrils.</a> Biochimica et Biophysica Acta. 1804, 1405-1412 (2010).</li><li>Minic, J., Sautel, M., Salesse, R., Pajot-Augy, E. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Yeast+system+as+a+screening+tool+for+pharmacological+assessment+of+g+protein+coupled+receptors.">Yeast system as a screening tool for pharmacological assessment of g protein coupled receptors.</a> Current Medicinal Chemistry. 12, 961-969 (2005).</li><li>Schein, C. H. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=A+cool+way+to+make+proteins.">A cool way to make proteins.</a> Nature Biotechnology. 22, 826-827 (2004).</li><li>Sorensen, H. P., Mortensen, K. K. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Advanced+genetic+strategies+for+recombinant+protein+expression+in+Escherichia+coli.">Advanced genetic strategies for recombinant protein expression in Escherichia coli.</a> Journal of Biotechnology. 115, 113-128 (2005).</li><li>Zhang, J., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Disruption+of+glycosylation+enhances+ubiquitin-mediated+proteasomal+degradation+of+Shadoo+in+Scrapie-infected+rodents+and+cultured+cells.">Disruption of glycosylation enhances ubiquitin-mediated proteasomal degradation of Shadoo in Scrapie-infected rodents and cultured cells.</a> Molecular Neurobiology. 49, 1373-1384 (2014).</li><li>Englund, P. T. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+structure+and+biosynthesis+of+glycosyl+phosphatidylinositol+protein+anchors.">The structure and biosynthesis of glycosyl phosphatidylinositol protein anchors.</a> Annual Review of Biochemistry. 62, 121-138 (1993).</li><li>Puig, B., Altmeppen, H., Glatzel, M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+GPI-anchoring+of+PrP:+implications+in+sorting+and+pathogenesis.">The GPI-anchoring of PrP: implications in sorting and pathogenesis.</a> Prion. 8, 11-18 (2014).</li></ol>

The authors have nothing to disclose.

Un protocole simple et efficace à la fois pour l&#39;expression et la purification d&#39;une grande quantité de protéine recombinante Shadoo souris est présentée. La méthode décrite permet solubilisation succès et la purification de (Son 6) protéine recombinante Shadoo -tagged. Il est important, comme indiqué dans le titre, qui lorsqu&#39;elle est exprimée dans une bactérie procaryote E. coli Shadoo accumule dans des corps d&#39;inclusion. Avant purification Shadoo, les bactéries doivent...

Prions maladies neurodégénératives, qui comprennent l&#39;encéphalopathie spongiforme bovine chez les bovins, tremblante du mouton et la maladie de Creutzfeldt-Jakob chez l&#39;homme, sont mortelles et incurables. Les maladies à prions sont caractérisés par des changements de conformation de la protéine prion cellulaire principalement composées d&#39;hélices a, dans la β-coupe-feuille enrichi amyloïde conformère 1,2. Croix-ß-structures contiennent denses et des feuillets bêta de type cristallin hautement ordonnés stabilisées par des liaisons hydrogène 3,4. Amyloïdes à prions peuvent se reproduire en raison des brins ß au bord de croissance qui fournissent un modèle pour le recrutement et la conversion d&#39;une unité de protéine monomère. Selon l&#39;hypothèse de «protéine seulement», le conformère amyloïde de la protéine prion est le seul agent infectieux. Toutefois, d&#39;autres biomolécules ont été proposés pour être essentiel pour troubles liés au prion. Par exemple, les membranes cellulaires sont pensés pour être un lieu où conversisur place et prend certains lipides chargés négativement ont été montré pour améliorer la 5,6 processus de conversion. En outre, certaines protéines peuvent également être impliqués dans des pathologies à prions. Plus précisément, il existe deux autres membres de la famille de la protéine prion: Doppel Shadoo et 7,8. Doppel a une structure relativement rigide stabilisé avec des ponts di-sulfure et ne parvient pas à l&#39;auto-polymériser et globale de fibrilles amyloïdes 9. En revanche, similaire à la protéine prion, Shadoo peut adopter une structure β-feuille enrichi et l&#39;auto-associé dans les structures de fibrilles amyloïdes. Il a été montré que Shadoo peut fibrillation dans des conditions natives ou sur membranes chargées négativement de liaison 10,11. Conversion de Shadoo en fibres de type amyloïde peut être associée à des pathologies. En effet, les mécanismes par lesquels les structures de type amyloïde causent la maladie sont encore mal compris. Shadoo porte un domaine hydrophobe (HD) et une série de tandem Arg / Gly répète similaires to la partie N-terminale de la protéine prion (figure 1A). Comme la partie N-terminale de la protéine prion, Shadoo est fortement chargée positivement et semble être une protéine native non structurées 11,12. Shadoo semble être fonctionnellement lié à des troubles du prion, car il peut se lier directement la protéine prion. En outre, son expression est régulée au cours bas prion pathologique 13,14. Cependant, le rôle de Shadoo dans la maladie à prions est pas encore établie. Nous avons développé un plasmide portant la séquence codante du gène de la souris Shadoo. Le plasmide a été utilisé pour transformer E. coli pour la production de N-terminal Son 6 protéine de fusion Shadoo. Ce système d&#39;expression est bien établi dans notre laboratoire et est couramment utilisé dans nos projets en cours 6,15,16. Une question importante pour l&#39;expression de Shadoo est le choix de la E. coli. Bien souche bactérienne BL21 compétente est couramment utilisé pour l&#39;expression de pro recombinantprotéines Shadoo a été exprimé avec succès et purifié seulement de la souche bactérienne transformée SoluBL21. SoluBL21 E. compétente coli est un mutant amélioré de la souche hôte BL21 mis au point pour la production de protéines dont l&#39;expression dans la BL21-mère a donné aucun produit soluble détectable. Expression de haut niveau de Shadoo dans SoluBL21 E. coli conduit à l&#39;accumulation de la protéine dans des corps d&#39;inclusion. Comme une caractéristique générale, quand une protéine non-natif est fortement exprimé dans E. coli, cette protéine a tendance à s&#39;accumuler dans les corps d&#39;inclusion insolubles. Shadoo agrégats probablement par des interactions hydrophobes non covalentes ou ioniques (ou une combinaison des deux) à des structures dynamiques hautement enrichi formés par la protéine repliée à des degrés divers. En conséquence, la purification comprend au moins deux étapes: (i) une séparation sélective de la protéine à partir d&#39;autres biomolécules dans un milieu de dénaturation, et (ii) une renaturation de la protéine purifiée en utilisant dans le pliage vitroTechniques. La séparation sélective de Shadoo a été réalisée dans une solution tampon contenant de l&#39;urée 8 M (ou en variante de guanidine-HCl 6 M). L&#39;élimination de l&#39;urée et la renaturation de la protéine peut être fait en appliquant différents protocoles: (i) la renaturation dans une solution de pH acide pour obtenir une protéine de Shadoo monomère non structurée, ou (ii) la renaturation dans une solution de pH ≥ 7 pour obtenir Shadoo polymérisé en fibres amyloïdes caractéristiques stables avec motifs croix-β-feuille.

<table>
	<tbody>
		<tr>
			<td>AKTA FPLC&#160;</td>
			<td>GE, Amersham</td>
			<td># 1363</td>
			<td></td>
		</tr>
		<tr>
			<td>HiLoad 16/60 Superdex</td>
			<td>GE Healthcare</td>
			<td>17-1069-01</td>
			<td></td>
		</tr>
		<tr>
			<td>HiTrap IMAC</td>
			<td>GE Healthcare</td>
			<td>GE17-0920-05</td>
			<td></td>
		</tr>
		<tr>
			<td>HiPrep26/10 Desalting column</td>
			<td>GE Healthcare</td>
			<td>GE17-5087-01</td>
			<td></td>
		</tr>
		<tr>
			<td>SoluBL21 Competent E. coli</td>
			<td>Genlantis</td>
			<td>C700200</td>
			<td></td>
		</tr>
		<tr>
			<td>pET-28b+</td>
			<td>Novogen</td>
			<td>69865-3</td>
			<td></td>
		</tr>
		<tr>
			<td>IPTG</td>
			<td>Sigma-Aldrich</td>
			<td>I6758</td>
			<td></td>
		</tr>
		<tr>
			<td>LB-Broth medium</td>
			<td>Sigma-Aldrich</td>
			<td>L3022</td>
			<td></td>
		</tr>
		<tr>
			<td>Eppendorf Biophotometar</td>
			<td>Eppendorf</td>
			<td>550507804</td>
			<td></td>
		</tr>
		<tr>
			<td>Trito X-100</td>
			<td>Life Technologies</td>
			<td>85111</td>
			<td></td>
		</tr>
		<tr>
			<td>NiSO4</td>
			<td>Sigma-Aldrich</td>
			<td>656895</td>
			<td></td>
		</tr>
		<tr>
			<td>EDTA</td>
			<td>Sigma-Aldrich</td>
			<td>E6758</td>
			<td></td>
		</tr>
		<tr>
			<td>Tris-HCl</td>
			<td>Sigma-Aldrich</td>
			<td>RES3098T</td>
			<td></td>
		</tr>
		<tr>
			<td>Protease Inhibitor Cocktail Tablets</td>
			<td>Roche</td>
			<td>4693116001</td>
			<td></td>
		</tr>
		<tr>
			<td>NaCl</td>
			<td>Sigma-Aldrich</td>
			<td>746398</td>
			<td></td>
		</tr>
		<tr>
			<td>Imidazol</td>
			<td>Sigma-Aldrich</td>
			<td>I5513</td>
			<td></td>
		</tr>
		<tr>
			<td>Gdn-HCl</td>
			<td>Sigma-Aldrich</td>
			<td>G4505</td>
			<td></td>
		</tr>
		<tr>
			<td>protein size marker&#160;</td>
			<td>Thermo Fisher Scientific</td>
			<td>26620</td>
			<td></td>
		</tr>
	</tbody>
</table>

purification and refolding to amyloid fibrils of (his)6-tagged recombinant shadoo protein expressed as inclusion bodies in e. coli

Le système d&#39;expression d&#39;Escherichia coli est un outil puissant pour la production de protéines eucaryotes recombinantes. On l&#39;utilise pour produire Shadoo, une protéine appartenant à la famille des prions. Procédé chromatographique pour la purification de (His) 6 recombinant -tagged Shadoo exprimé en corps d&#39;inclusion sont décrits. Les corps d&#39;inclusion sont solubilisés dans de l&#39;urée 8 M et lié à une colonne -charged Ni 2+ à effectuer une chromatographie d&#39;affinité d&#39;ions. Les protéines liées sont éluées par un gradient d&#39;imidazole. Les fractions contenant la protéine Shadoo sont soumis à une Chromatographie d&#39;exclusion de taille pour obtenir une protéine hautement purifiée. Dans l&#39;étape finale est purifié Shadoo dessalée pour éliminer les sels, de l&#39;urée et de l&#39;imidazole. Protéine recombinante Shadoo est un réactif importante pour les études biophysiques et biochimiques de troubles de la conformation de la protéine qui se produisent dans les maladies à prions. De nombreux rapports ont démontré que les maladies neurodégénératives prion proviennent du dépôt de poignarderle, a ordonné fibrilles amyloïdes. Protocoles exemples décrivant comment la fibrillation Shadoo en fibrilles amyloïdes à pH acide et neutre / pH basiques sont présentés. Les méthodes sur la façon de produire et de fibrillation Shadoo peut faciliter la recherche dans les laboratoires travaillant sur les maladies à prions, car elle permet la production de grandes quantités de protéines d&#39;une manière rapide et à faible coût.

A propos de 5-10 mg de protéine purifiée est obtenue Shadoo par litre de culture bactérienne. Une purification en deux étapes est nécessaire pour obtenir Shadoo recombinante de haute pureté. La première étape est réalisée par chromatographie d&#39;affinité avec une colonne de Ni qui conserve ses -charged-protéines marquées. Les fractions éluées sont soumises à une SDS-PAGE et colorées au bleu de Coomassie Brilliant avec (figure 5A). Les fractions contenant la protéine sont r...

Watch this Scientific Journal Video about Purification and Refolding to Amyloid Fibrils of His6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli at JoVE.com

Purification and Refolding to Amyloid Fibrils of His6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli

A two-step chromatographic method is described for the purification of recombinant Shadoo protein expressed as inclusion bodies in Escherichia coli, as well as a protocol to fibrillate purified Shadoo into amyloid structures.

Purification et le repliement de fibrilles d&#39;amyloïde de (Son)<sub&gt; 6</sub&gt; -tagged protéine recombinante Shadoo Exprimé en corps d&#39;inclusion dans<em&gt; E. coli</em

The Escherichia coli expression system is a powerful tool for the production of recombinant eukaryotic proteins. We use it to produce Shadoo, a protein ...

purification-refolding-to-amyloid-fibrils-his6-tagged-recombinant

Research

JoVE Journal

Biology

Purification and Refolding to Amyloid Fibrils of (His)6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli

14.1K vues.  INRA. A two-step chromatographic method is described for the purification of recombinant Shadoo protein expressed as inclusion bodies in Escherichia coli, as well as a protocol to fibrillate purified Shadoo into amyloid structures. 

Vidéo: Purification and Refolding to Amyloid Fibrils of His6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli

Staining of Proteins in Gels with Coomassie G-250 without Organic Solvent and Acetic Acid

In classical protein staining protocols using Coomassie Brilliant Blue (CBB), solutions with high contents of toxic and flammable organic solvents (Methanol, Ethanol or 2-Propanol) and acetic acid are used for fixation, staining and destaining of proteins in a gel after SDS-PAGE. To speed up the procedure, heating the staining solution in the microwave oven for a short time is frequently used. This usually results in evaporation of toxic or hazardous Methanol, Ethanol or 2-Propanol and a strong smell of acetic acid in the lab which should be avoided due to safety considerations. In a protocol originally published in two patent applications by E.M. Wondrak (US2001046709 (A1), US6319720 (B1)), an alternative composition of the staining solution is described in which no organic solvent or acid is used. The CBB is dissolved in bidistilled water (60-80mg of CBB G-250 per liter) and 35 mM HCl is added as the only other compound in the staining solution. The CBB staning of the gel is done after SDS-PAGE and thorough washing of the gel in bidistilled water. By heating the gel during the washing and staining steps, the process can be finished faster and no toxic or hazardous compunds are evaporating. The staining of proteins occurs already within 1 minute after heating the gel in staining solution and is fully developed after 15-30 min with a slightly blue background that is destained completely by prolonged washing of the stained gel in bidistilled water, without affecting the stained protein bands.

A short protocol for protein staining with Coomassie Brilliant Blue (CBB) G-250 in polyacrylamide gels is described without using organic solvents or acetic acid as in the classical staining procedures with CBB.

Coloration des protéines dans les gels de Coomassie G-250, sans solvant et l&#39;acide acétique organique

In classical protein staining protocols using Coomassie Brilliant Blue (CBB), solutions with high contents of toxic and flammable organic solvents ...

Recherche

Biologie

Mutagenesis and Functional Selection Protocols for Directed Evolution of Proteins in E. coli

The efficient generation of genetic diversity represents an invaluable molecular tool that can be used to label DNA synthesis, to create unique molecular signatures, or to evolve proteins in the laboratory. Here, we present a protocol that allows the generation of large (>1011) mutant libraries for a given target sequence. This method is based on replication of a ColE1 plasmid encoding the desired sequence by a low-fidelity variant of DNA polymerase I (LF-Pol I). The target plasmid is transformed into a mutator strain of E. coli and plated on solid media, yielding between 0.2 and 1 mutations/kb, depending on the location of the target gene. Higher mutation frequencies are achieved by iterating this process of mutagenesis. Compared to alternative methods of mutagenesis, our protocol stands out for its simplicity, as no cloning or PCR are involved. Thus, our method is ideal for mutational labeling of plasmids or other Pol I templates or to explore large sections of sequence space for the evolution of activities not present in the original target. The tight spatial control that PCR or randomized oligonucleotide-based methods offer can also be achieved through subsequent cloning of specific sections of the library. Here we provide protocols showing how to create a random mutant library and how to establish drug-based selections in E. coli to identify mutants exhibiting new biochemical activities.

Mutagenesis and Functional Selection Protocols for Directed Evolution of Proteins in E. coli

Here we demonstrate a simple protocol to create a random mutant library for a given target sequence. We show how this method, which is performed in vivo in Escherichia coli, can be coupled with functional selections to evolve new enzymatic activities.

Protocoles de sélection mutagenèse et fonctionnelles pour l&#39;évolution dirigée de protéines dans les E. coli</em

The efficient generation of genetic diversity represents an invaluable molecular tool that can be used to label DNA synthesis, to create unique molecular ...

Purification of Hsp104, a Protein Disaggregase

Hsp104 is a hexameric AAA+ protein1 from yeast, which couples ATP hydrolysis to protein disaggregation2-10 (Fig. 1). This activity imparts two key selective advantages. First, renaturation of disordered aggregates by Hsp104 empowers yeast survival after various protein-misfolding stresses, including heat shock3,5,11,12. Second, remodeling of cross-beta amyloid fibrils by Hsp104 enables yeast to exploit myriad prions (infectious amyloids) as a reservoir of beneficial and heritable phenotypic variation13-22. Remarkably, Hsp104 directly remodels preamyloid oligomers and amyloid fibrils, including those comprised of the yeast prion proteins Sup35 and Ure223-30. This amyloid-remodeling functionality is a specialized facet of yeast Hsp104. The E. coli orthologue, ClpB, fails to remodel preamyloid oligomers or amyloid fibrils26,31,32.
Hsp104 orthologues are found in all kingdoms of life except, perplexingly, animals. Indeed, whether animal cells possess any enzymatic system that couples protein disaggregation to renaturation (rather than degradation) remains unknown33-35. Thus, we and others have proposed that Hsp104 might be developed as a therapeutic agent for various neurodegenerative diseases connected with the misfolding of specific proteins into toxic preamyloid oligomers and amyloid fibrils4,7,23,36-38. There are no treatments that directly target the aggregated species associated with these diseases. Yet, Hsp104 dissolves toxic oligomers and amyloid fibrils composed of alpha-synuclein, which are connected with Parkinson's Disease23 as well as amyloid forms of PrP39. Importantly, Hsp104 reduces protein aggregation and ameliorates neurodegeneration in rodent models of Parkinson's Disease23 and Huntington's disease38. Ideally, to optimize therapy and minimize side effects, Hsp104 would be engineered and potentiated to selectively remodel specific aggregates central to the disease in question4,7. However, the limited structural and mechanistic understanding of how Hsp104 disaggregates such a diverse repertoire of aggregated structures and unrelated proteins frustrates these endeavors30,40-42.
To understand the structure and mechanism of Hsp104, it is essential to study the pure protein and reconstitute its disaggregase activity with minimal components. Hsp104 is a 102kDa protein with a pI of ~5.3, which hexamerizes in the presence of ADP or ATP, or at high protein concentrations in the absence of nucleotide43-46. Here, we describe an optimized protocol for the purification of highly active, stable Hsp104 from E. coli. The use of E. coli allows simplified large-scale production and our method can be performed quickly and reliably for numerous Hsp104 variants. Our protocol increases Hsp104 purity and simplifies His6-tag removal compared to a previous purification method from E. coli47. Moreover, our protocol is more facile and convenient than two more recent protocols26,48.

Here, we describe a protocol for the purification of highly active Hsp104, a hexameric AAA+ protein from yeast, which couples ATP hydrolysis to protein disaggregation. This scheme exploits a His6-tagged construct for affinity purification from E. coli followed by anion-exchange chromatography, His6-tag removal with TEV protease, and size-exclusion chromatography.

Purification de Hsp104, une protéine Disaggregase

Hsp104 is a hexameric AAA+ protein1 from yeast, which couples ATP hydrolysis to protein disaggregation2-10 (Fig. 1). This activity imparts two key ...

Identification of Protein Complexes in Escherichia coli using Sequential Peptide Affinity Purification in Combination with Tandem Mass Spectrometry

Since most cellular processes are mediated by macromolecular assemblies, the systematic identification of protein-protein interactions (PPI) and the identification of the subunit composition of multi-protein complexes can provide insight into gene function and enhance understanding of biological systems1, 2. Physical interactions can be mapped with high confidence vialarge-scale isolation and characterization of endogenous protein complexes under near-physiological conditions based on affinity purification of chromosomally-tagged proteins in combination with mass spectrometry (APMS). This approach has been successfully applied in evolutionarily diverse organisms, including yeast, flies, worms, mammalian cells, and bacteria1-6. In particular, we have generated a carboxy-terminal Sequential Peptide Affinity (SPA) dual tagging system for affinity-purifying native protein complexes from cultured gram-negative Escherichia coli, using genetically-tractable host laboratory strains that are well-suited for genome-wide investigations of the fundamental biology and conserved processes of prokaryotes1, 2, 7. Our SPA-tagging system is analogous to the tandem affinity purification method developed originally for yeast8, 9, and consists of a calmodulin binding peptide (CBP) followed by the cleavage site for the highly specific tobacco etch virus (TEV) protease and three copies of the FLAG epitope (3X FLAG), allowing for two consecutive rounds of affinity enrichment. After cassette amplification, sequence-specific linear PCR products encoding the SPA-tag and a selectable marker are integrated and expressed in frame as carboxy-terminal fusions in a DY330 background that is induced to transiently express a highly efficient heterologous bacteriophage lambda recombination system10. Subsequent dual-step purification using calmodulin and anti-FLAG affinity beads enables the highly selective and efficient recovery of even low abundance protein complexes from large-scale cultures. Tandem mass spectrometry is then used to identify the stably co-purifying proteins with high sensitivity (low nanogram detection limits).
Here, we describe detailed step-by-step procedures we commonly use for systematic protein tagging, purification and mass spectrometry-based analysis of soluble protein complexes from E. coli, which can be scaled up and potentially tailored to other bacterial species, including certain opportunistic pathogens that are amenable to recombineering. The resulting physical interactions can often reveal interesting unexpected components and connections suggesting novel mechanistic links. Integration of the PPI data with alternate molecular association data such as genetic (gene-gene) interactions and genomic-context (GC) predictions can facilitate elucidation of the global molecular organization of multi-protein complexes within biological pathways. The networks generated for E. coli can be used to gain insight into the functional architecture of orthologous gene products in other microbes for which functional annotations are currently lacking.

Identification of Protein Complexes in Escherichia coli using Sequential Peptide Affinity Purification in Combination with Tandem Mass Spectrometry

Affinity purification of tagged proteins in combination with mass spectrometry (APMS) is a powerful method for the systematic mapping of protein interaction networks and for investigating the mechanistic basis of biological processes. Here, we describe an optimized sequential peptide affinity (SPA) APMS procedure developed for the bacterium Escherichia coli that can be used to isolate and characterize stable multi-protein complexes to near homogeneity even starting from low copy numbers per cell.

Identification des complexes protéiques dans<em&gt; Escherichia coli</em&gt; En utilisant séquentielle Purification par affinité peptide en combinaison avec la spectrométrie de masse en tandem

Since most cellular processes are mediated by macromolecular assemblies, the systematic identification of protein-protein interactions (PPI) and the ...

Coupled Assays for Monitoring Protein Refolding in Saccharomyces cerevisiae

Proteostasis, defined as the combined processes of protein folding/biogenesis, refolding/repair, and degradation, is a delicate cellular balance that must be maintained to avoid deleterious consequences 1. External or internal factors that disrupt this balance can lead to protein aggregation, toxicity and cell death. In humans this is a major contributing factor to the symptoms associated with neurodegenerative disorders such as Huntington's, Parkinson's, and Alzheimer's diseases 10. It is therefore essential that the proteins involved in maintenance of proteostasis be identified in order to develop treatments for these debilitating diseases. This article describes techniques for monitoring in vivo protein folding at near-real time resolution using the model protein firefly luciferase fused to green fluorescent protein (FFL-GFP). FFL-GFP is a unique model chimeric protein as the FFL moiety is extremely sensitive to stress-induced misfolding and aggregation, which inactivates the enzyme 12. Luciferase activity is monitored using an enzymatic assay, and the GFP moiety provides a method of visualizing soluble or aggregated FFL using automated microscopy. These coupled methods incorporate two parallel and technically independent approaches to analyze both refolding and functional reactivation of an enzyme after stress. Activity recovery can be directly correlated with kinetics of disaggregation and re-solubilization to better understand how protein quality control factors such as protein chaperones collaborate to perform these functions. In addition, gene deletions or mutations can be used to test contributions of specific proteins or protein subunits to this process. In this article we examine the contributions of the protein disaggregase Hsp104 13, known to partner with the Hsp40/70/nucleotide exchange factor (NEF) refolding system 5, to protein refolding to validate this approach.

Coupled Assays for Monitoring Protein Refolding in Saccharomyces cerevisiae

This article describes the use of a firefly luciferase-GFP fusion protein to investigate in vivo protein folding in Saccharomyces cerevisiae. Using this reagent, refolding of a model heat-denatured protein can be monitored simultaneously by fluorescence microscopy and an enzymatic assay to probe the roles of proteostasis network components in protein quality control.

Les analyses couplées pour la surveillance protéines repliement<em&gt; Saccharomyces cerevisiae</em

Proteostasis, defined as the combined processes of protein folding/biogenesis, refolding/repair, and degradation, is a delicate cellular balance that must ...

Purification of the Cystic Fibrosis Transmembrane Conductance Regulator Protein Expressed in Saccharomyces cerevisiae

Defects in the cystic fibrosis transmembrane conductance regulator (CFTR) protein cause cystic fibrosis (CF), an autosomal recessive disease that currently limits the average life expectancy of sufferers to &#60;40 years of age. The development of novel drug molecules to restore the activity of CFTR is an important goal in the treatment CF, and the isolation of functionally active CFTR is a useful step towards achieving this goal.
We describe two methods for the purification of CFTR from a eukaryotic heterologous expression system, S. cerevisiae. Like prokaryotic systems, S. cerevisiae can be rapidly grown in the lab at low cost, but can also traffic and posttranslationally modify large membrane proteins. The selection of detergents for solubilization and purification is a critical step in the purification of any membrane protein. Having screened for the solubility of CFTR in several detergents, we have chosen two contrasting detergents for use in the purification that allow the final CFTR preparation to be tailored to the subsequently planned experiments.
In this method, we provide comparison of the purification of CFTR in dodecyl-&#946;-D-maltoside (DDM) and 1-tetradecanoyl-sn-glycero-3-phospho-(1&#39;-rac-glycerol) (LPG-14). Protein purified in DDM by this method shows ATPase activity in functional assays. Protein purified in LPG-14 shows high purity and yield, can be employed to study post-translational modifications, and can be used for structural methods such as small-angle X-ray scattering and electron microscopy. However it displays significantly lower ATPase activity.

Purification of the Cystic Fibrosis Transmembrane Conductance Regulator Protein Expressed in Saccharomyces cerevisiae

Heterologous expression and purification of the cystic fibrosis transmembrane conductance regulator (CFTR) are significant challenges and limiting factors in the development of drug therapies for cystic fibrosis. This protocol describes two methods for the isolation of milligram quantities of CFTR suitable for functional and structural studies.&#160;

Purification de la fibrose kystique régulateur de la conductance transmembranaire protéine exprimée dans<em&gt; Saccharomyces cerevisiae</em

Defects in the cystic fibrosis transmembrane conductance regulator (CFTR) protein cause cystic fibrosis (CF), an autosomal recessive disease that ...

High Throughput Quantitative Expression Screening and Purification Applied to Recombinant Disulfide-rich Venom Proteins Produced in E. coli

Escherichia coli (E. coli) is the most widely used expression system for the production of recombinant proteins for structural and functional studies. However, purifying proteins is sometimes challenging since many proteins are expressed in an insoluble form. When working with difficult or multiple targets it is therefore recommended to use high throughput (HTP) protein expression screening on a small scale (1-4&#160;ml cultures) to quickly identify conditions for soluble expression. To cope with the various structural genomics programs of the lab, a quantitative (within a range of 0.1-100 mg/L culture of recombinant protein) and HTP protein expression screening protocol was implemented and validated on thousands of proteins. The protocols were automated with the use of a liquid handling robot but can also be performed manually without specialized equipment.
Disulfide-rich venom proteins are gaining increasing recognition for their potential as therapeutic drug leads. They can be highly potent and selective, but their complex disulfide bond networks make them challenging to produce. As a member of the FP7 European Venomics project (<a href="http://www.venomics.eu">www.venomics.eu</a>), our challenge is to develop successful production strategies with the aim of producing thousands of novel venom proteins for functional characterization. Aided by the redox properties of disulfide bond isomerase DsbC, we adapted our HTP production pipeline for the expression of oxidized, functional venom peptides in the E. coli cytoplasm. The protocols are also applicable to the production of diverse disulfide-rich proteins. Here we demonstrate our pipeline applied to the production of animal venom proteins. With the protocols described herein it is likely that soluble disulfide-rich proteins will be obtained in as little as a week. Even from a small scale, there is the potential to use the purified proteins for validating the oxidation state by mass spectrometry, for characterization in pilot studies, or for sensitive micro-assays.

High Throughput Quantitative Expression Screening and Purification Applied to Recombinant Disulfide-rich Venom Proteins Produced in E. coli

A protocol for the quantitative, high throughput expression screening and analytical purification of fusion proteins from small-scale Escherichia coli cultures is described and applied to the expression of disulfide-rich animal venom protein targets.

High Throughput Screening Expression quantitative et purification appliquée à recombinant disulfure riches protéines venin produit dans<em&gt; E. coli</em

Escherichia coli (E. coli) is the most widely used expression system for the production of recombinant proteins for structural and functional studies. ...

Non-chromatographic Purification of Recombinant Elastin-like Polypeptides and their Fusions with Peptides and Proteins from Escherichia coli

Elastin-like polypeptides are repetitive biopolymers that exhibit a lower critical solution temperature phase transition behavior, existing as soluble unimers below a characteristic transition temperature and aggregating into micron-scale coacervates above their transition temperature. The design of elastin-like polypeptides at the genetic level permits precise control of their sequence and length, which dictates their thermal properties. Elastin-like polypeptides are used in a variety of applications including biosensing, tissue engineering, and drug delivery, where the transition temperature and biopolymer architecture of the ELP can be tuned for the specific application of interest. Furthermore, the lower critical solution temperature phase transition behavior of elastin-like polypeptides allows their purification by their thermal response, such that their selective coacervation and resolubilization allows the removal of both soluble and insoluble contaminants following expression in Escherichia coli. This approach can be used for the purification of elastin-like polypeptides alone or as a purification tool for peptide or protein fusions where recombinant peptides or proteins genetically appended to elastin-like polypeptide tags can be purified without chromatography. This protocol describes the purification of elastin-like polypeptides and their peptide or protein fusions and discusses basic characterization techniques to assess the thermal behavior of pure elastin-like polypeptide products.

Non-chromatographic Purification of Recombinant Elastin-like Polypeptides and their Fusions with Peptides and Proteins from Escherichia coli

Elastin-like polypeptides are stimulus-responsive biopolymers with applications ranging from recombinant protein purification to drug delivery. This protocol describes the purification and characterization of elastin-like polypeptides and their peptide or protein fusions from Escherichia coli using their lower critical solution temperature phase transition behavior as a simple alternative to chromatography.

Purification non chromatographique de polypeptides recombinants élastine et de leurs fusions avec des peptides et des protéines<em&gt; Escherichia coli</em

Elastin-like polypeptides are repetitive biopolymers that exhibit a lower critical solution temperature phase transition behavior, existing as soluble ...

Green Fluorescent Protein-based Expression Screening of Membrane Proteins in Escherichia coli

The production of recombinant membrane proteins for structural and functional studies remains technically challenging due to low levels of expression and the inherent instability of many membrane proteins once solubilized in detergents. A protocol is described that combines ligation independent cloning of membrane proteins as GFP fusions with expression in Escherichia coli detected by GFP fluorescence. This enables the construction and expression screening of multiple membrane protein/variants to identify candidates suitable for further investment of time and effort. The GFP reporter is used in a primary screen of expression by visualizing GFP fluorescence following SDS polyacrylamide gel electrophoresis (SDS-PAGE). Membrane proteins that show both a high expression level with minimum degradation as indicated by the absence of free GFP, are selected for a secondary screen. These constructs are scaled and a total membrane fraction prepared and solubilized in four different detergents. Following ultracentrifugation to remove detergent-insoluble material, lysates are analyzed by fluorescence detection size exclusion chromatography (FSEC). Monitoring the size exclusion profile by GFP fluorescence provides information about the mono-dispersity and integrity of the membrane proteins in different detergents. Protein: detergent combinations that elute with a symmetrical peak with little or no free GFP and minimum aggregation are candidates for subsequent purification. Using the above methodology, the heterologous expression in E. coli of SED (shape, elongation, division, and sporulation) proteins from 47 different species of bacteria was analyzed. These proteins typically have ten transmembrane domains and are essential for cell division. The results show that the production of the SEDs orthologues in E. coli was highly variable with respect to the expression levels and integrity of the GFP fusion proteins. The experiment identified a subset for further investigation.

Green Fluorescent Protein-based Expression Screening of Membrane Proteins in Escherichia coli

A streamlined approach to screening for the expression of recombinant membrane proteins in Escherichia coli based on fusion to green fluorescent protein is presented.

Green Fluorescent Protein base Expression dépistage des protéines membranaires dans<em&gt; Escherichia coli</em

The production of recombinant membrane proteins for structural and functional studies remains technically challenging due to low levels of expression and ...

Phage-mediated Delivery of Targeted sRNA Constructs to Knock Down Gene Expression in E. coli

RNA-mediated knockdowns are widely used to control gene expression. This versatile family of techniques makes use of short RNA (sRNA) that can be synthesized with any sequence and designed to complement any gene targeted for silencing. Because sRNA constructs can be introduced to many cell types directly or using a variety of vectors, gene expression can be repressed in living cells without laborious genetic modification. The most common RNA knockdown technology, RNA interference (RNAi), makes use of the endogenous RNA-induced silencing complex (RISC) to mediate sequence recognition and cleavage of the target mRNA. Applications of this technique are therefore limited to RISC-expressing organisms, primarily eukaryotes. Recently, a new generation of RNA biotechnologists have developed alternative mechanisms for controlling gene expression through RNA, and so made possible RNA-mediated gene knockdowns in bacteria. Here we describe a method for silencing gene expression in E. coli that functionally resembles RNAi. In this system a synthetic phagemid is designed to express sRNA, which may designed to target any sequence. The expression construct is delivered to a population of E. coli cells with non-lytic M13 phage, after which it is able to stably replicate as a plasmid. Antisense recognition and silencing of the target mRNA is mediated by the Hfq protein, endogenous to E. coli. This protocol includes methods for designing the antisense sRNA, constructing the phagemid vector, packaging the phagemid into M13 bacteriophage, preparing a live cell population for infection, and performing the infection itself. The fluorescent protein mKate2 and the antibiotic resistance gene chloramphenicol acetyltransferase (CAT) are targeted to generate representative data and to quantify knockdown effectiveness.

Phage-mediated Delivery of Targeted sRNA Constructs to Knock Down Gene Expression in E. coli

We describe a method to knock down gene expression in a growing population of E. coli cells using sequence-targeted sRNA expression cassettes delivered by an M13 phagemid vector.